Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257850 829 bp mRNA linear INV 02-SEP-2023 (LOC106091356), mRNA. ACCESSION XM_013257850 VERSION XM_013257850.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257850.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..829 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..829 /gene="LOC106091356" /note="uncharacterized LOC106091356; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106091356" CDS 58..579 /gene="LOC106091356" /codon_start=1 /product="uncharacterized protein LOC106091356" /protein_id="XP_013113304.2" /db_xref="GeneID:106091356" /translation="MKDRIYLARFYYRASRNLEETKLLIEANYHFRSKHPNVFFNRDP DSDSIQQSTEFFHMVTLPGLTTDNSRVTLVKLKSTDANMMHHIEDVKYLFTFYDYRVS LPDVVENGKPYIVNGVIQIVDMKGITMRHAAKTSFTILAAAIKYLQKCCPSTLKGLHL VNCPSYINRLFAW" ORIGIN 1 gccccaccca aaaacccaac caaatgaacc aaccgattgg gacaaaatgg ctatcaaatg 61 aaagatcgca tatatctagc tcgcttttac tatcgagcat cccgaaattt ggaagagact 121 aaattgttaa tagaagccaa ttaccatttt cgctccaagc atcccaatgt gtttttcaac 181 cgcgatccgg atagtgacag cattcaacaa tctacagaat tttttcatat ggtaaccctg 241 cctggcttga caaccgataa cagtcgagta acgcttgtca aattaaaaag taccgatgca 301 aatatgatgc accatatcga agatgtgaag tacttgttca ccttctatga ctatcgtgta 361 tctttacctg acgtagtaga gaacggcaag ccctacattg taaatggtgt tatacaaatt 421 gtagatatga aaggcataac aatgagacat gcagccaaga cttctttcac aattttggca 481 gctgctatca aatatctaca gaaatgttgt cctagtactc tcaaaggctt acatctcgta 541 aattgtccct cgtatattaa taggctgttt gcttggtgaa gccattttta aaaaaggaat 601 ggattgaaat gacacatttt catgttaaca acttgggaac actttacaat tatgtgcctc 661 gggaaatgct aaccgaagag tatggaggca atgcaggaaa aatatcagat ttggctgaga 721 gttcattaaa agaaatacag tcaaaaagag actatattat ggaccccgat tactgggtgg 781 tgaaataagc tttttttcct ataaactaat aatgaaatgt agatataga