Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257849 969 bp mRNA linear INV 02-SEP-2023 protein-like (LOC106091355), transcript variant X2, mRNA. ACCESSION XM_013257849 VERSION XM_013257849.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257849.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..969 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..969 /gene="LOC106091355" /note="alpha-tocopherol transfer protein-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106091355" CDS 181..897 /gene="LOC106091355" /codon_start=1 /product="uncharacterized protein LOC106091355 isoform X2" /protein_id="XP_013113303.2" /db_xref="GeneID:106091355" /translation="MEFIGDSDQEKIIDDLQKWFEENDKLPKKINRLLLTRFYYCMFK DVEETKNLIEINYAMRQRAPTIFITRDPTDEDTQNSAAYADMVLLPGMTPDNCRVSLL YINNPDPKMMHHAQDIKAYFMVTDYRFSMPDMITSEGKALLAEGEIKIIDMKHFTLKH IPRLSIWALRTTIKYLQEAYPIHFHTDDLERLYDHVPRQMLVEEHGGQAGKISDYKEE LIQSVTDKREYLMDLDYWKV" ORIGIN 1 caactcatca aatataatta gacgatatcg attaactccc tgtggaaaat gaatatcatt 61 ttccatataa tttagctaaa atgttggcag tcagattatg gtagtgaaac aaacccgacc 121 taaatttgtt gtaaagttgt caaagtacaa aaaaaaacac cacttcttat ttagaaagac 181 atggagttta ttggagactc agatcaagaa aagatcattg atgatttgca aaaatggttt 241 gaagagaacg ataagttgcc taagaaaata aatcgcttac tcttgacacg tttctattac 301 tgcatgttca aagatgtaga agaaaccaaa aacttgattg aaatcaacta tgccatgaga 361 caaagggcac ccaccatttt tataacacgt gatcctacgg atgaagacac tcaaaattct 421 gctgcatatg ccgacatggt actattgcca ggaatgacac cagacaactg tcgagtctca 481 ttattatata taaataatcc ggatccaaaa atgatgcatc atgcccaaga tatcaaggcc 541 tattttatgg tcaccgatta tcgcttttcc atgcctgaca tgataacaag tgagggcaaa 601 gcactgctgg cagagggaga aatcaaaatt atcgatatga agcactttac gctgaagcat 661 ataccacgtt tatcgatatg ggctttgcga acgaccatca aatatttgca agaagcttat 721 ccgatacact ttcatacaga tgatttagag agactatacg atcatgttcc caggcaaatg 781 ttggttgagg aacatggagg tcaagctggt aaaatatcgg attataaaga ggagcttata 841 caatctgtaa cggacaagag agaatatctt atggatctcg attactggaa ggtctaaaaa 901 tgccactaca gttgtagctc tggtaaaaac ctttaaaaat ttgctgtttt taaaattata 961 gttttgaga