Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-tocopherol transfer


LOCUS       XM_013257849             969 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC106091355), transcript variant X2, mRNA.
ACCESSION   XM_013257849
VERSION     XM_013257849.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257849.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..969
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..969
                     /gene="LOC106091355"
                     /note="alpha-tocopherol transfer protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106091355"
     CDS             181..897
                     /gene="LOC106091355"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091355 isoform X2"
                     /protein_id="XP_013113303.2"
                     /db_xref="GeneID:106091355"
                     /translation="MEFIGDSDQEKIIDDLQKWFEENDKLPKKINRLLLTRFYYCMFK
                     DVEETKNLIEINYAMRQRAPTIFITRDPTDEDTQNSAAYADMVLLPGMTPDNCRVSLL
                     YINNPDPKMMHHAQDIKAYFMVTDYRFSMPDMITSEGKALLAEGEIKIIDMKHFTLKH
                     IPRLSIWALRTTIKYLQEAYPIHFHTDDLERLYDHVPRQMLVEEHGGQAGKISDYKEE
                     LIQSVTDKREYLMDLDYWKV"
ORIGIN      
        1 caactcatca aatataatta gacgatatcg attaactccc tgtggaaaat gaatatcatt
       61 ttccatataa tttagctaaa atgttggcag tcagattatg gtagtgaaac aaacccgacc
      121 taaatttgtt gtaaagttgt caaagtacaa aaaaaaacac cacttcttat ttagaaagac
      181 atggagttta ttggagactc agatcaagaa aagatcattg atgatttgca aaaatggttt
      241 gaagagaacg ataagttgcc taagaaaata aatcgcttac tcttgacacg tttctattac
      301 tgcatgttca aagatgtaga agaaaccaaa aacttgattg aaatcaacta tgccatgaga
      361 caaagggcac ccaccatttt tataacacgt gatcctacgg atgaagacac tcaaaattct
      421 gctgcatatg ccgacatggt actattgcca ggaatgacac cagacaactg tcgagtctca
      481 ttattatata taaataatcc ggatccaaaa atgatgcatc atgcccaaga tatcaaggcc
      541 tattttatgg tcaccgatta tcgcttttcc atgcctgaca tgataacaag tgagggcaaa
      601 gcactgctgg cagagggaga aatcaaaatt atcgatatga agcactttac gctgaagcat
      661 ataccacgtt tatcgatatg ggctttgcga acgaccatca aatatttgca agaagcttat
      721 ccgatacact ttcatacaga tgatttagag agactatacg atcatgttcc caggcaaatg
      781 ttggttgagg aacatggagg tcaagctggt aaaatatcgg attataaaga ggagcttata
      841 caatctgtaa cggacaagag agaatatctt atggatctcg attactggaa ggtctaaaaa
      901 tgccactaca gttgtagctc tggtaaaaac ctttaaaaat ttgctgtttt taaaattata
      961 gttttgaga