Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257848 1060 bp mRNA linear INV 02-SEP-2023 protein-like (LOC106091355), transcript variant X1, mRNA. ACCESSION XM_013257848 VERSION XM_013257848.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257848.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1060 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1060 /gene="LOC106091355" /note="alpha-tocopherol transfer protein-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106091355" CDS 173..988 /gene="LOC106091355" /codon_start=1 /product="alpha-tocopherol transfer protein-like isoform X1" /protein_id="XP_013113302.2" /db_xref="GeneID:106091355" /translation="MEFIGDSDQEKIIDDLQKWFEENDKLPKKINRLLLTRFYYCMFK DVEETKNLIEINYAMRQRAPTIFITRDPTDEDTQNSAAYADMVLLPGMTPDNCRVSLL YINNPDPKMMHHAQDIKAYFMVTDYRFSMPDMITSEGKALLAEGEIKIIDMKHFTLKH IPRLSIWALRTTIKYLQEAYPVRIKSIHIVNCPPYMNKIIAIVRPFISQRVFELIHFH TDDLERLYDHVPRQMLVEEHGGQAGKISDYKEELIQSVTDKREYLMDLDYWKV" ORIGIN 1 caaatataat tagacgatat cgattaactc cctgtggaaa atgaatatca ttttccatat 61 aatttagcta aaatgttggc agtcagatta tggtagtgaa acaaacccga cctaaatttg 121 ttgtaaagtt gtcaaagtac aaaaaaaaac accacttctt atttagaaag acatggagtt 181 tattggagac tcagatcaag aaaagatcat tgatgatttg caaaaatggt ttgaagagaa 241 cgataagttg cctaagaaaa taaatcgctt actcttgaca cgtttctatt actgcatgtt 301 caaagatgta gaagaaacca aaaacttgat tgaaatcaac tatgccatga gacaaagggc 361 acccaccatt tttataacac gtgatcctac ggatgaagac actcaaaatt ctgctgcata 421 tgccgacatg gtactattgc caggaatgac accagacaac tgtcgagtct cattattata 481 tataaataat ccggatccaa aaatgatgca tcatgcccaa gatatcaagg cctattttat 541 ggtcaccgat tatcgctttt ccatgcctga catgataaca agtgagggca aagcactgct 601 ggcagaggga gaaatcaaaa ttatcgatat gaagcacttt acgctgaagc atataccacg 661 tttatcgata tgggctttgc gaacgaccat caaatatttg caagaagctt atccggtgcg 721 cattaaaagc atccacattg ttaattgtcc accgtatatg aataaaataa tagccattgt 781 taggccattt atcagtcaaa gagtttttga attgatacac tttcatacag atgatttaga 841 gagactatac gatcatgttc ccaggcaaat gttggttgag gaacatggag gtcaagctgg 901 taaaatatcg gattataaag aggagcttat acaatctgta acggacaaga gagaatatct 961 tatggatctc gattactgga aggtctaaaa atgccactac agttgtagct ctggtaaaaa 1021 cctttaaaaa tttgctgttt ttaaaattat agttttgaga