Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-tocopherol transfer


LOCUS       XM_013257848            1060 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC106091355), transcript variant X1, mRNA.
ACCESSION   XM_013257848
VERSION     XM_013257848.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257848.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1060
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1060
                     /gene="LOC106091355"
                     /note="alpha-tocopherol transfer protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106091355"
     CDS             173..988
                     /gene="LOC106091355"
                     /codon_start=1
                     /product="alpha-tocopherol transfer protein-like isoform
                     X1"
                     /protein_id="XP_013113302.2"
                     /db_xref="GeneID:106091355"
                     /translation="MEFIGDSDQEKIIDDLQKWFEENDKLPKKINRLLLTRFYYCMFK
                     DVEETKNLIEINYAMRQRAPTIFITRDPTDEDTQNSAAYADMVLLPGMTPDNCRVSLL
                     YINNPDPKMMHHAQDIKAYFMVTDYRFSMPDMITSEGKALLAEGEIKIIDMKHFTLKH
                     IPRLSIWALRTTIKYLQEAYPVRIKSIHIVNCPPYMNKIIAIVRPFISQRVFELIHFH
                     TDDLERLYDHVPRQMLVEEHGGQAGKISDYKEELIQSVTDKREYLMDLDYWKV"
ORIGIN      
        1 caaatataat tagacgatat cgattaactc cctgtggaaa atgaatatca ttttccatat
       61 aatttagcta aaatgttggc agtcagatta tggtagtgaa acaaacccga cctaaatttg
      121 ttgtaaagtt gtcaaagtac aaaaaaaaac accacttctt atttagaaag acatggagtt
      181 tattggagac tcagatcaag aaaagatcat tgatgatttg caaaaatggt ttgaagagaa
      241 cgataagttg cctaagaaaa taaatcgctt actcttgaca cgtttctatt actgcatgtt
      301 caaagatgta gaagaaacca aaaacttgat tgaaatcaac tatgccatga gacaaagggc
      361 acccaccatt tttataacac gtgatcctac ggatgaagac actcaaaatt ctgctgcata
      421 tgccgacatg gtactattgc caggaatgac accagacaac tgtcgagtct cattattata
      481 tataaataat ccggatccaa aaatgatgca tcatgcccaa gatatcaagg cctattttat
      541 ggtcaccgat tatcgctttt ccatgcctga catgataaca agtgagggca aagcactgct
      601 ggcagaggga gaaatcaaaa ttatcgatat gaagcacttt acgctgaagc atataccacg
      661 tttatcgata tgggctttgc gaacgaccat caaatatttg caagaagctt atccggtgcg
      721 cattaaaagc atccacattg ttaattgtcc accgtatatg aataaaataa tagccattgt
      781 taggccattt atcagtcaaa gagtttttga attgatacac tttcatacag atgatttaga
      841 gagactatac gatcatgttc ccaggcaaat gttggttgag gaacatggag gtcaagctgg
      901 taaaatatcg gattataaag aggagcttat acaatctgta acggacaaga gagaatatct
      961 tatggatctc gattactgga aggtctaaaa atgccactac agttgtagct ctggtaaaaa
     1021 cctttaaaaa tttgctgttt ttaaaattat agttttgaga