Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mitochondrial inner membrane


LOCUS       XM_013257845             912 bp    mRNA    linear   INV 02-SEP-2023
            protease subunit 1 (LOC106091353), mRNA.
ACCESSION   XM_013257845
VERSION     XM_013257845.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257845.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..912
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..912
                     /gene="LOC106091353"
                     /note="mitochondrial inner membrane protease subunit 1;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 9 Proteins"
                     /db_xref="GeneID:106091353"
     CDS             52..558
                     /gene="LOC106091353"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease subunit 1"
                     /protein_id="XP_013113299.1"
                     /db_xref="GeneID:106091353"
                     /translation="MKFISHLKDIMKYSIQYMCVTHCFFEYVGDFVVCNGPSMEPTLH
                     SNNILLTERITTRFHKPNRGDIIIAVSPTNPEQYICKRVIGLPGDKVIADNLPQNEES
                     EALNKSSADKYTPTFNGDYVPKGFVWIEGDNQSNSADSRYYGPIPLGLVRSRAICRIW
                     PLSEAKVL"
     misc_feature    154..531
                     /gene="LOC106091353"
                     /note="Signal peptidase, peptidase S26; Region:
                     Peptidase_S26; pfam10502"
                     /db_xref="CDD:431321"
     polyA_site      912
                     /gene="LOC106091353"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtttttctta gcattttcat aactagaatt aaaaatagtg gaaagtagat aatgaaattt
       61 atttcacatt tgaaagatat tatgaagtac agcatacaat acatgtgtgt tacccattgc
      121 tttttcgaat atgttggcga ttttgttgtg tgcaatggtc catcgatgga acccacacta
      181 cactcaaata atatactgct gacagagcga attaccacac ggttccataa acccaatcgt
      241 ggtgacatta ttatagctgt atctcctaca aatccagagc aatatatatg taaacgggtt
      301 ataggcctgc ctggtgataa ggtcatagcc gacaatctac ctcagaatga agagagtgaa
      361 gcacttaaca agtcatctgc cgataaatat acacctacct tcaatggtga ctacgttcca
      421 aagggattcg tatggattga gggtgacaat cagtccaata gtgcagattc ccgttactat
      481 ggtcctatac cattaggtct tgtaagaagt agagcaattt gtagaatatg gcctttgagt
      541 gaggcaaaag ttttatgaaa ggcgtaggtg aagaaaatgg aaatatgtat gagaaaatag
      601 aagacgctaa ttatatatgt ttttgttttt ttaaattgtc acaagacaaa gtagtcagta
      661 ccacaataca acggaactga agtatgccct aatttatatt atccatagta tatgaagtgg
      721 gctgaaagca taccatcgca ctgttccgac ctgtttcata gttttcttgt ttacttcatt
      781 aattagtagt agtcagactc tttaattatc ttaaatttct gtaagtgaaa cacttacaaa
      841 ccaatttata taacaaattt tttttgtagg taaaattact ttaataaata aatagctgaa
      901 aatagcagga aa