Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257845 912 bp mRNA linear INV 02-SEP-2023 protease subunit 1 (LOC106091353), mRNA. ACCESSION XM_013257845 VERSION XM_013257845.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257845.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..912 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..912 /gene="LOC106091353" /note="mitochondrial inner membrane protease subunit 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106091353" CDS 52..558 /gene="LOC106091353" /codon_start=1 /product="mitochondrial inner membrane protease subunit 1" /protein_id="XP_013113299.1" /db_xref="GeneID:106091353" /translation="MKFISHLKDIMKYSIQYMCVTHCFFEYVGDFVVCNGPSMEPTLH SNNILLTERITTRFHKPNRGDIIIAVSPTNPEQYICKRVIGLPGDKVIADNLPQNEES EALNKSSADKYTPTFNGDYVPKGFVWIEGDNQSNSADSRYYGPIPLGLVRSRAICRIW PLSEAKVL" misc_feature 154..531 /gene="LOC106091353" /note="Signal peptidase, peptidase S26; Region: Peptidase_S26; pfam10502" /db_xref="CDD:431321" polyA_site 912 /gene="LOC106091353" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtttttctta gcattttcat aactagaatt aaaaatagtg gaaagtagat aatgaaattt 61 atttcacatt tgaaagatat tatgaagtac agcatacaat acatgtgtgt tacccattgc 121 tttttcgaat atgttggcga ttttgttgtg tgcaatggtc catcgatgga acccacacta 181 cactcaaata atatactgct gacagagcga attaccacac ggttccataa acccaatcgt 241 ggtgacatta ttatagctgt atctcctaca aatccagagc aatatatatg taaacgggtt 301 ataggcctgc ctggtgataa ggtcatagcc gacaatctac ctcagaatga agagagtgaa 361 gcacttaaca agtcatctgc cgataaatat acacctacct tcaatggtga ctacgttcca 421 aagggattcg tatggattga gggtgacaat cagtccaata gtgcagattc ccgttactat 481 ggtcctatac cattaggtct tgtaagaagt agagcaattt gtagaatatg gcctttgagt 541 gaggcaaaag ttttatgaaa ggcgtaggtg aagaaaatgg aaatatgtat gagaaaatag 601 aagacgctaa ttatatatgt ttttgttttt ttaaattgtc acaagacaaa gtagtcagta 661 ccacaataca acggaactga agtatgccct aatttatatt atccatagta tatgaagtgg 721 gctgaaagca taccatcgca ctgttccgac ctgtttcata gttttcttgt ttacttcatt 781 aattagtagt agtcagactc tttaattatc ttaaatttct gtaagtgaaa cacttacaaa 841 ccaatttata taacaaattt tttttgtagg taaaattact ttaataaata aatagctgaa 901 aatagcagga aa