Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans alpha-tocopherol transfer


LOCUS       XM_013257842            1297 bp    mRNA    linear   INV 02-SEP-2023
            protein-like (LOC106091350), mRNA.
ACCESSION   XM_013257842
VERSION     XM_013257842.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257842.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1297
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1297
                     /gene="LOC106091350"
                     /note="alpha-tocopherol transfer protein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106091350"
     CDS             305..1129
                     /gene="LOC106091350"
                     /codon_start=1
                     /product="alpha-tocopherol transfer protein-like"
                     /protein_id="XP_013113296.1"
                     /db_xref="GeneID:106091350"
                     /translation="MQAIGDAEQEKTIDYLQKWFEENKKLPNKIDRILLTRFYYCMYK
                     DVEETKKLLEINYTIRNDYPHIYIERDPTDHDTINAFAYTDMVPLPGLTAENYRITFL
                     RLTDFDPSMMHHTEDTKTFIMVSDCRFSIPDVVKGDTPLLSEGEVQIFDMNGYTMKHV
                     ARLSFRTLRTYLKFLQLAFPVRIKAMHMINCPSYLDKILMVVKPFISKEVFEMIHFHT
                     NGIETLYDYVPKEMLPEEYGGNAGKLSDLKAVFRKTLEEKRDYLMDPNHWRVGNSK"
     misc_feature    560..1024
                     /gene="LOC106091350"
                     /note="Sec14p-like lipid-binding domain; Region: SEC14;
                     cd00170"
                     /db_xref="CDD:469559"
     polyA_site      1297
                     /gene="LOC106091350"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgagttagt agacagcggt actcctttgc agaaatacga aatacaacac aaagcgcaca
       61 agctctccat ataaacccaa aaatcaaaca aaataaacaa acataaaact tccaacgctc
      121 gaattgcaag cacatagtac aattacctat ttaaggaaat tcatgaaaag aaaaattaag
      181 ctaaaaaaat agcagaatta cattggaaat taattaagtg aatgattaca attcatgtac
      241 atatataatt taaagaaaac gcgtgtgcat taaacaaatt cacaaaaaaa aacaaagcta
      301 aaaaatgcag gcaattggtg atgcggaaca agagaagacc atcgattact tgcaaaaatg
      361 gtttgaggag aacaaaaagt tgccaaacaa aattgaccgc attctattga cccgttttta
      421 ttactgcatg tacaaagatg ttgaggaaac caaaaaacta ttggaaataa actataccat
      481 acgcaatgac tatccacata tctatattga acgtgacccc acagaccacg atacaatcaa
      541 tgcatttgcg tatacagata tggtacctct gccaggttta acggcagaaa attatcgcat
      601 cacatttctt cgtttaactg actttgatcc tagtatgatg catcacaccg aagataccaa
      661 aacctttatc atggtaagcg attgccgatt ctcaattcca gatgtggtaa agggtgacac
      721 tccattgctg tcagagggtg aagtacaaat ttttgatatg aacggttata ccatgaaaca
      781 tgtggcacga ttatcattta gaactttacg cacttatttg aagtttttac aattggcctt
      841 tccggtgcgg ataaaggcca tgcacatgat taactgtcca tcgtatttgg ataaaattct
      901 gatggtggtg aagccattca taagcaaaga ggtctttgaa atgattcatt ttcataccaa
      961 tggcatagag actttatacg attatgtacc caaagaaatg ttacctgaag aatatggtgg
     1021 caatgctggt aaactaagtg atttgaaggc agtattcaga aaaaccctgg aggagaaaag
     1081 ggattactta atggacccta atcattggag agtggggaac tccaagtaat tgtacaagct
     1141 ttactatgca tttcactttg ttgtgtgttt tttccttatt gttatataca tatgtattat
     1201 aaatgttatt aaaaacgttt tgtgatttat actgtttact taattcttta tataagaaaa
     1261 tttaataaat atattttcct attaatgttc cgcaaaa