Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans breast cancer metastasis-suppressor


LOCUS       XM_013257698            1070 bp    mRNA    linear   INV 02-SEP-2023
            1-like protein (LOC106091226), mRNA.
ACCESSION   XM_013257698
VERSION     XM_013257698.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257698.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1070
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1070
                     /gene="LOC106091226"
                     /note="breast cancer metastasis-suppressor 1-like protein;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 6 Proteins"
                     /db_xref="GeneID:106091226"
     CDS             191..901
                     /gene="LOC106091226"
                     /codon_start=1
                     /product="breast cancer metastasis-suppressor 1-like
                     protein"
                     /protein_id="XP_013113152.1"
                     /db_xref="GeneID:106091226"
                     /translation="MPVKNGGESDGGAGSNSESEHSNSSQGHESSDEEANEIDSDDSS
                     EMDVNEIERRRSECLEILDHLEKQFSQLREQYYTERINQIERQSAEVRNGRSEEYLQP
                     LKELDKVYKNRIEVAEILKRYRLENIEHKFLSEEQAALQNFESEKQLALDQIYDDLME
                     KIRRLEEDRHNVDISWDDWGNDKRHSKVRGPARKKAVTVNGPFIVYMLHEEDILEDWT
                     TIRKALKRSTTMVGPVAT"
     misc_feature    362..>802
                     /gene="LOC106091226"
                     /note="Sds3-like; Region: Sds3; pfam08598"
                     /db_xref="CDD:430099"
     polyA_site      1070
                     /gene="LOC106091226"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gatacatcta cacatctacg tttagacacc tacaagaagc tagctggctg ctaaaataga
       61 aattacattg ttttttattg aaaaaagcaa agaaaacata aaattaaaat agaaaacacg
      121 tcgatttgag ctacatattc ctcggcaaga taggaaaatt tgccatagct gatctaagtt
      181 tccacataag atgcctgtga aaaatggtgg cgaatccgat ggtggtgccg gttccaactc
      241 ggaatccgag cattccaact ccagccaagg ccatgagtcc agcgatgagg aggcaaatga
      301 aattgattcg gacgattcat ccgaaatgga tgtgaatgag atcgaaaggc gacgttcaga
      361 atgtttagaa atcctagacc atttagaaaa acaatttagc cagctccggg aacaatatta
      421 caccgaacgt attaatcaaa ttgaaaggca atcggccgaa gtgcgcaatg gaagatccga
      481 ggaatatttg caacccttaa aggagctaga caaagtttat aaaaatcgca ttgaggtggc
      541 agaaatttta aaacgatatc gtttggaaaa catagagcat aagttcttga gcgaggaaca
      601 agcagcgtta caaaactttg agagtgaaaa acaattggct ttagatcaaa tttatgatga
      661 cctcatggag aaaataagac gcctggagga ggaccgacat aatgtagata tctcctggga
      721 cgattggggc aatgacaaac gtcatagcaa agtgcggggg ccggcccgca aaaaggctgt
      781 cactgtcaat ggacctttca ttgtgtatat gctgcacgaa gaagatattt tagaagactg
      841 gactactata cgcaaagccc ttaaacgttc aaccacaatg gtgggccctg ttgcaacatg
      901 accctaaacc attcacttat ccatccctat cttttaatga actagtactc attctctgct
      961 tcctaactgc tattctttca taaggtattc atttggtttc tagttttagt tcttaagttt
     1021 tgaaataaaa aaattctact aagtgtggaa attttaacaa attaacaaaa