Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106091118


LOCUS       XM_013257540             905 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106091118), mRNA.
ACCESSION   XM_013257540
VERSION     XM_013257540.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257540.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..905
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..905
                     /gene="LOC106091118"
                     /note="uncharacterized LOC106091118; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 16
                     Proteins"
                     /db_xref="GeneID:106091118"
     CDS             344..817
                     /gene="LOC106091118"
                     /codon_start=1
                     /product="uncharacterized protein LOC106091118"
                     /protein_id="XP_013112994.1"
                     /db_xref="GeneID:106091118"
                     /translation="MKFLVNTFAVLLVVACVSGAATENKEKDTKEAATAAAPAEASIK
                     IYKRLIPADVLRDFPGMCFASTRCATVEVGKSWELTPFCGRSTCVQNEEDPTKLLELV
                     EDCGPLPLANDKCKLDTEKTNKTAAFPFCCPIFTCEPGVKLEYPEAIKEAPAKKE"
     misc_feature    551..754
                     /gene="LOC106091118"
                     /note="Single domain von Willebrand factor type C; Region:
                     SVWC; pfam15430"
                     /db_xref="CDD:464713"
     polyA_site      905
                     /gene="LOC106091118"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aattttgaaa tttaattcag tgctcacttt cgcttgcaac ggttcgtgag ttggtttttt
       61 gtaaacattt ctggagaaac aatcatacta aaaacacacg actaaaaacg atcgattcgt
      121 acctacaaca tcagcattat ttggccaaaa caaaataaaa aaaaaccgtc tagaggctta
      181 aagcgtgtat ctgtaattca aaaacaacac aatcacacaa aatttgcaaa ttaaataacc
      241 cccaacagca acaacaataa acaaaacaaa aaaactgcaa aaaatctatt cgttccaccc
      301 taataaattt taactaaaga agaagcaaaa caaacaaagc aaaatgaaat tcttggtcaa
      361 cacattcgcc gtattgttgg tggtagcctg cgtcagtgga gctgccacag aaaataaaga
      421 aaaagacaca aaggaagctg caaccgccgc tgctccagct gaggcttcca tcaaaatcta
      481 taaacgcctg ataccagctg atgtgctaag agattttcct ggcatgtgct ttgcttccac
      541 tcgctgtgct actgttgaag ttggaaaatc ttgggaacta acaccattct gtggtcgttc
      601 aacttgtgtg caaaatgagg aagatcctac aaaattgttg gaattagtcg aagattgcgg
      661 tcccttgcca ttggctaatg acaagtgtaa attggacaca gagaagacca acaaaactgc
      721 tgccttcccc ttttgctgtc ccatcttcac ctgcgaacct ggtgtaaaat tggaatatcc
      781 tgaagccatc aaagaggcgc cagctaagaa ggagtaattc taactctagg ctatttcatc
      841 tctgtaaata ctattcaata aatacaaaat ccccctaaaa aatacaaaat atcatacaac
      901 ttgaa