Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257540 905 bp mRNA linear INV 02-SEP-2023 (LOC106091118), mRNA. ACCESSION XM_013257540 VERSION XM_013257540.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257540.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..905 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..905 /gene="LOC106091118" /note="uncharacterized LOC106091118; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:106091118" CDS 344..817 /gene="LOC106091118" /codon_start=1 /product="uncharacterized protein LOC106091118" /protein_id="XP_013112994.1" /db_xref="GeneID:106091118" /translation="MKFLVNTFAVLLVVACVSGAATENKEKDTKEAATAAAPAEASIK IYKRLIPADVLRDFPGMCFASTRCATVEVGKSWELTPFCGRSTCVQNEEDPTKLLELV EDCGPLPLANDKCKLDTEKTNKTAAFPFCCPIFTCEPGVKLEYPEAIKEAPAKKE" misc_feature 551..754 /gene="LOC106091118" /note="Single domain von Willebrand factor type C; Region: SVWC; pfam15430" /db_xref="CDD:464713" polyA_site 905 /gene="LOC106091118" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aattttgaaa tttaattcag tgctcacttt cgcttgcaac ggttcgtgag ttggtttttt 61 gtaaacattt ctggagaaac aatcatacta aaaacacacg actaaaaacg atcgattcgt 121 acctacaaca tcagcattat ttggccaaaa caaaataaaa aaaaaccgtc tagaggctta 181 aagcgtgtat ctgtaattca aaaacaacac aatcacacaa aatttgcaaa ttaaataacc 241 cccaacagca acaacaataa acaaaacaaa aaaactgcaa aaaatctatt cgttccaccc 301 taataaattt taactaaaga agaagcaaaa caaacaaagc aaaatgaaat tcttggtcaa 361 cacattcgcc gtattgttgg tggtagcctg cgtcagtgga gctgccacag aaaataaaga 421 aaaagacaca aaggaagctg caaccgccgc tgctccagct gaggcttcca tcaaaatcta 481 taaacgcctg ataccagctg atgtgctaag agattttcct ggcatgtgct ttgcttccac 541 tcgctgtgct actgttgaag ttggaaaatc ttgggaacta acaccattct gtggtcgttc 601 aacttgtgtg caaaatgagg aagatcctac aaaattgttg gaattagtcg aagattgcgg 661 tcccttgcca ttggctaatg acaagtgtaa attggacaca gagaagacca acaaaactgc 721 tgccttcccc ttttgctgtc ccatcttcac ctgcgaacct ggtgtaaaat tggaatatcc 781 tgaagccatc aaagaggcgc cagctaagaa ggagtaattc taactctagg ctatttcatc 841 tctgtaaata ctattcaata aatacaaaat ccccctaaaa aatacaaaat atcatacaac 901 ttgaa