Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257299 921 bp mRNA linear INV 02-SEP-2023 (LOC106090935), mRNA. ACCESSION XM_013257299 VERSION XM_013257299.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257299.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..921 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..921 /gene="LOC106090935" /note="uncharacterized LOC106090935; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090935" CDS 64..783 /gene="LOC106090935" /codon_start=1 /product="uncharacterized protein LOC106090935" /protein_id="XP_013112753.1" /db_xref="GeneID:106090935" /translation="MKFISLTLAVIISASMAVAAVAPYLPPKPENNSFGRDKSSENEV FAASAPAALYAAPSADSSTLSQDHAIPKESSSASATIPVILALSPVTAAATLPIGQIA PSIVYGSQGGLIQAGSVPALQYLASGQIVAGPTSLHQSAAIVPAASSAALQYFNPGIS TITQPGGFLQAAASPTVQYIVPSGVSYGHIQAASAPIQSYAAPASGQIFLAATSQPGG FIANGGTRYALNGGYANKIKK" polyA_site 921 /gene="LOC106090935" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tagcaaactc ttcctactgc gacttcagtt tgaaattatt tatttagtag actagaacgc 61 actatgaaat tcatttcctt aactttagcc gttatcatat cagcctcaat ggctgtggct 121 gcggttgccc cctatttgcc gcctaagcct gaaaacaaca gttttggcag agacaaatca 181 tctgagaatg aagtatttgc ggcaagtgct cctgcggcac tatatgcagc tccttcagct 241 gatagttcaa cactctccca agatcatgca attcccaaag aatcatcctc tgcatcagct 301 accatacctg tgattttagc tttaagtccc gttactgctg ctgccaccct tcccatagga 361 caaattgccc cttctattgt ctatggcagt cagggaggcc ttatacaagc aggttccgtt 421 cctgcactcc aataccttgc ttctggtcaa attgttgctg gtccaacatc gctacaccaa 481 tctgctgcca tagtaccagc agcatcttct gctgcccttc aatacttcaa tccaggtata 541 tccaccatta cccagcctgg aggattctta caagcagcag cctctcccac tgttcaatac 601 atagttccct ctggagtttc ctatggccat atacaagcag cttcagcacc catacaaagt 661 tatgcagccc ctgccagtgg tcaaatcttc ctggctgcta cgagtcaacc aggaggtttt 721 attgctaatg gaggaactcg gtatgcattg aatggtggct atgcaaataa gattaagaaa 781 tgataaaatg caaatattta aatacgtttg tagggtaata aatattgttt tgacataatt 841 ttaaaatgtg atagcatcaa tgaaatattt gcttcattat tcccagatgt gaaacaaata 901 aaatgaaact ggttaaagga a