Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090935


LOCUS       XM_013257299             921 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090935), mRNA.
ACCESSION   XM_013257299
VERSION     XM_013257299.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257299.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..921
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..921
                     /gene="LOC106090935"
                     /note="uncharacterized LOC106090935; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090935"
     CDS             64..783
                     /gene="LOC106090935"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090935"
                     /protein_id="XP_013112753.1"
                     /db_xref="GeneID:106090935"
                     /translation="MKFISLTLAVIISASMAVAAVAPYLPPKPENNSFGRDKSSENEV
                     FAASAPAALYAAPSADSSTLSQDHAIPKESSSASATIPVILALSPVTAAATLPIGQIA
                     PSIVYGSQGGLIQAGSVPALQYLASGQIVAGPTSLHQSAAIVPAASSAALQYFNPGIS
                     TITQPGGFLQAAASPTVQYIVPSGVSYGHIQAASAPIQSYAAPASGQIFLAATSQPGG
                     FIANGGTRYALNGGYANKIKK"
     polyA_site      921
                     /gene="LOC106090935"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tagcaaactc ttcctactgc gacttcagtt tgaaattatt tatttagtag actagaacgc
       61 actatgaaat tcatttcctt aactttagcc gttatcatat cagcctcaat ggctgtggct
      121 gcggttgccc cctatttgcc gcctaagcct gaaaacaaca gttttggcag agacaaatca
      181 tctgagaatg aagtatttgc ggcaagtgct cctgcggcac tatatgcagc tccttcagct
      241 gatagttcaa cactctccca agatcatgca attcccaaag aatcatcctc tgcatcagct
      301 accatacctg tgattttagc tttaagtccc gttactgctg ctgccaccct tcccatagga
      361 caaattgccc cttctattgt ctatggcagt cagggaggcc ttatacaagc aggttccgtt
      421 cctgcactcc aataccttgc ttctggtcaa attgttgctg gtccaacatc gctacaccaa
      481 tctgctgcca tagtaccagc agcatcttct gctgcccttc aatacttcaa tccaggtata
      541 tccaccatta cccagcctgg aggattctta caagcagcag cctctcccac tgttcaatac
      601 atagttccct ctggagtttc ctatggccat atacaagcag cttcagcacc catacaaagt
      661 tatgcagccc ctgccagtgg tcaaatcttc ctggctgcta cgagtcaacc aggaggtttt
      721 attgctaatg gaggaactcg gtatgcattg aatggtggct atgcaaataa gattaagaaa
      781 tgataaaatg caaatattta aatacgtttg tagggtaata aatattgttt tgacataatt
      841 ttaaaatgtg atagcatcaa tgaaatattt gcttcattat tcccagatgt gaaacaaata
      901 aaatgaaact ggttaaagga a