Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans cuticle protein 16.5 (LOC106090934),


LOCUS       XM_013257297             865 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013257297
VERSION     XM_013257297.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257297.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 10% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..865
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..865
                     /gene="LOC106090934"
                     /note="cuticle protein 16.5; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106090934"
     CDS             50..865
                     /gene="LOC106090934"
                     /codon_start=1
                     /product="cuticle protein 16.5"
                     /protein_id="XP_013112751.1"
                     /db_xref="GeneID:106090934"
                     /translation="MKFFIAFALLAVAAADVSHLSKKYLPATQNSVETSYTSSASAPA
                     PAPVAQSAPAAAPAPAPAQVQTPAATYGAPVVQQSYSAPAVQQTYSAPATFQQEYSAP
                     VAAPISEYLPPVQQTFSAPAVHQSFSTPAFQQSFAAPAVSYAAPAVSYSAPAVSYSAP
                     AVQQTFAPAPSVSYSAPAFQQSFAAPAVSYSAPAVQQTYSAPSFQSSFAAPSVQTSFS
                     APAFQTSYAAPAVQTSYSAPSFQPSFTAPAVSVSSGNLGTQYAANGGYVYKKK"
     misc_feature    <245..>802
                     /gene="LOC106090934"
                     /note="DNA polymerase III subunit gamma/tau; Region:
                     PRK12323; cl46901"
                     /db_xref="CDD:481241"
ORIGIN      
        1 tccaactgta aactatcagc ccatcccaag ttttatccaa agactaaaaa tgaaattctt
       61 cattgctttt gctcttttgg ccgtagctgc cgccgatgtc agccatctgt ccaagaaata
      121 cttgccagcc acccaaaaca gtgtggaaac cagctatact tcctcagctt cggctccagc
      181 tcctgcccca gtagcccaat cagcccccgc agctgcccca gctcccgctc cagctcaagt
      241 tcaaactcca gctgccacct atggtgcccc tgttgtgcaa caaagctatt cggcccccgc
      301 tgttcaacag acctacagtg ctcctgctac cttccaacag gaatacagtg ctcccgttgc
      361 agctccaatc agtgaatact tgccccctgt ccaacagacc ttctctgctc ccgctgtgca
      421 ccagtcattc tctaccccag ctttccaaca atcttttgct gctccagctg ttagctatgc
      481 tgccccagct gttagctata gcgctcccgc tgtcagctac tcggctccag ctgtccaaca
      541 aacgtttgcc cctgctccct cagttagcta ttccgctcca gctttccaac aatcctttgc
      601 cgctcctgct gtaagctact ctgccccagc cgttcaacaa acttactccg ctcccagctt
      661 ccaaagctca ttcgctgccc catctgttca gacctccttc tctgcaccag ctttccaaac
      721 ctcatatgct gctccagctg tgcaaacctc ctactccgcc ccatcattcc aaccatcctt
      781 caccgcccca gctgtcagcg tctccagtgg caacttgggt actcagtacg ctgccaacgg
      841 cggttatgtt tacaagaaga agtag