Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257295 1078 bp mRNA linear INV 02-SEP-2023 (LOC106090932), mRNA. ACCESSION XM_013257295 VERSION XM_013257295.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257295.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1078 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1078 /gene="LOC106090932" /note="histidine-rich glycoprotein-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106090932" CDS 47..1048 /gene="LOC106090932" /codon_start=1 /product="histidine-rich glycoprotein-like" /protein_id="XP_013112749.2" /db_xref="GeneID:106090932" /translation="MKIFIAILLALCAAATADVSHLKNLYLPPHEKAPSHHDDSVGSH GSHSSPNSVATSFDAFDSNGYTGSSESFGSGSYSAPVTTFAANSFGAGLKASDSETGS YGSGSYSAPATFISSTSYSADSAYSSLAAPDAHSSHHHADQHSYGGHQDQHSHHDGGH GQYESHGHHDSHGHQDSHGHQDSHGHQDSHGHQEGSHGHGHYESVQHHDSHGNSHHDS HSQHDHGHQGSHAQHDSHHDSHGHEEGHGHKESHGHQDSNGYHDSHGHKDNHGHQDSH HDSHGHQDSHENHGSHGHHDSHGSQGHQGSHDHDGQHSQHGHQTTDTQYAADGGYIY" ORIGIN 1 atcagtgttc tttgtttaag ttaagaagat tggcgaaatt gtcaaaatga aaatatttat 61 tgcaattttg ctggcattgt gtgctgcagc cacagcagac gtcagtcatt tgaagaatct 121 ctatttgcca cctcatgaaa aagctccatc acaccatgat gattccgtgg gttctcatgg 181 cagccattcg tcacccaata gtgttgcgac ctctttcgat gctttcgatt ctaatggcta 241 cacaggttct agtgagtctt ttggttcggg tagctattca gctcctgtaa caacattcgc 301 agcaaactcc tttggagcag gattaaaagc atctgattct gaaactggtt cctatggcag 361 tggcagttat tctgcaccgg ctacttttat aagttcaact tcttatagtg cggattccgc 421 ctatagttca ttagcagcac cagatgccca ttccagtcat catcatgcgg atcaacatag 481 ttacggcggg catcaagatc aacacagtca tcatgatggg ggacatggtc aatatgaaag 541 tcatggtcat catgacagcc atggacacca ggatagtcat ggacaccagg atagccatgg 601 acaccaggat agccatggac accaggaagg tagccacggt cacggtcatt acgaaagtgt 661 tcaacatcat gacagtcacg gtaacagcca tcatgatagt catagtcaac atgaccatgg 721 ccaccaaggc agtcatgctc agcacgacag ccatcatgac agtcatgggc acgaggaagg 781 acatggtcat aaggagagcc atggccatca ggatagtaac ggttatcacg acagccacgg 841 tcataaggac aatcacggcc accaagatag tcatcacgat agccatggtc atcaggatag 901 tcatgagaac catggcagcc atgggcacca tgatagtcac ggcagccagg gtcatcaagg 961 tagtcacgat catgacggcc aacacagtca acatggtcat caaaccacgg atacacaata 1021 tgctgccgat ggtggctaca tttattagaa taccctccac aagcaaaaaa caaatgcc