Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257294 912 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013257294 VERSION XM_013257294.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257294.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..912 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..912 /gene="LOC106090930" /note="cuticle protein 16.5; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106090930" CDS 128..802 /gene="LOC106090930" /codon_start=1 /product="cuticle protein 16.5" /protein_id="XP_013112748.1" /db_xref="GeneID:106090930" /translation="MKLFVAASFALLALASADVSHLSKSYLPPVQQSYSSAVVQQSYS APAVQHSYSAPAIQQSYSAPSNEYLPPVQQPTYSAPSVSYSAPAVHQSYSAPSVSYSA PAVQTTYSAPTVQTTYSAPAVQSTYSAPAAQSYSSYSSAPAVQQSFAVQEQYSAPSNE YLPPVQQTYSAPTVSYSAPAVQQSYSAPVSYQQQTFSSGSASSSYSGADVGTQYAANG GYVYKK" misc_feature <203..>709 /gene="LOC106090930" /note="DNA translocase FtsK; Provisional; Region: PRK10263" /db_xref="CDD:236669" ORIGIN 1 gaaagcatag ttttttggta tataaattgc gagtgcggct gacaaagagt atcagttccc 61 tcacttacct cacagagatc agtggtttag cacagccagc acaactcact ccaaatcatt 121 caacaacatg aaacttttcg ttgccgcttc ttttgctctc ttggccttgg cttccgccga 181 tgttagccac ttgtccaaga gctacttgcc tcctgtgcag caatcgtact cttcagctgt 241 tgtgcaacaa tcctactcgg ctcctgctgt gcaacactca tactcggctc ccgctataca 301 acagtcctac tcagctccct ccaacgagta cttgccccca gtgcaacagc caacctactc 361 agctccctcg gtgagttact ctgctcccgc tgtacaccaa agctactctg ctccctcagt 421 tagctactct gcccccgctg tgcaaaccac ctactctgct cccactgttc aaaccaccta 481 ctccgcccct gccgttcaaa gcacctactc tgccccagct gctcaatcct actcctcgta 541 ctcatccgct ccagctgtcc aacaatcgtt tgccgtgcaa gagcaatact ctgctccttc 601 caacgaatac ttgcctcccg ttcaacagac ctactctgct cccacagtta gctacagtgc 661 cccagctgtt cagcaatcct actcagctcc tgtctcctac caacaacaga ccttctcctc 721 cggctctgcc agcagcagtt actctggtgc tgatgtcggc actcaatatg ctgccaacgg 781 tggttatgtc tacaagaagt aaatgacaga gctgtgattc gacattcata ttttagtatt 841 tttgctccaa atagcttcat tcattcgtaa ttgttaaccc catctattgt taattaaatc 901 aattaatgtt tt