PREDICTED: Stomoxys calcitrans fork head domain transcription

LOCUS       XM_013257161             795 bp    mRNA    linear   INV 02-SEP-2023
            factor slp1 (LOC106090828), mRNA.
ACCESSION   XM_013257161
VERSION     XM_013257161.1
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 62% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..795
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..795
                     /gene="LOC106090828"
                     /note="fork head domain transcription factor slp1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106090828"
     CDS             1..795
                     /gene="LOC106090828"
                     /codon_start=1
                     /product="fork head domain transcription factor slp1"
                     /protein_id="XP_013112615.1"
                     /db_xref="GeneID:106090828"
                     /translation="MAPVFQSNFSIRSLLSDKKACYEDIETSYVPNAPISPSGSQSSS
                     SEELSSDDGSSTSSKSPDAKPAYTYSALIVMAIRSSPEKRLTLSGICEWIAENFAYYQ
                     KNKSVWQNSIRHNLSLNPCFVRVPRALDDPGRGHYWALDPSAEDLTIGETTGRLRRSN
                     NAMMGRSFGTGAMRNKAAMHYGSPYGGHHPYHQTMTNAMAYAHHYTPNAVYFPTPEEI
                     RLAQQTALIQSQREQQAWSSYQRQQQQMQQIHYHQQYLLQQGGIPM"
     misc_feature    190..438
                     /gene="LOC106090828"
                     /note="Forkhead domain; Region: Forkhead; pfam00250"
                     /db_xref="CDD:459732"
ORIGIN      
        1 atggctcctg tattccaatc gaatttctcc attcgttcac ttttatcgga taagaaagct
       61 tgctacgagg atattgaaac ttcatatgta cccaatgctc ccatcagccc ttccggttct
      121 caatcatcat cctcagagga attgtccagc gatgatggct catcgaccag cagcaaatcg
      181 ccagatgcaa aaccagccta cacctacagt gcccttatag ttatggccat tagaagtagc
      241 ccagagaaac gcctcaccct tagtggcatt tgcgaatgga tagccgaaaa ctttgcctac
      301 tatcagaaga acaaaagcgt atggcagaat tccatacgtc acaaccttag cttgaatccc
      361 tgctttgtga gagtacccag agccttggat gatccgggac gtggtcacta ttgggcttta
      421 gatccctcgg ccgaagattt gacaataggt gagaccaccg gacgtttaag acgcagcaac
      481 aatgcaatga tgggtcgctc ttttggaact ggtgccatgc gtaacaaagc tgccatgcac
      541 tatggctcac catatggtgg tcatcatccc tatcatcaaa caatgaccaa tgccatggcc
      601 tatgctcatc actacacacc aaatgctgtc tattttccaa ctcccgagga aattcgtttg
      661 gctcaacaaa ccgctttgat acaaagtcaa agggagcaac aagcttggtc ctcctatcag
      721 agacaacagc aacaaatgca gcaaatacac tatcatcaac aatatctgct acaacaggga
      781 ggcattccca tgtaa