Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257133 661 bp mRNA linear INV 02-SEP-2023 (LOC106090815), mRNA. ACCESSION XM_013257133 VERSION XM_013257133.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257133.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..661 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..661 /gene="LOC106090815" /note="uncharacterized LOC106090815; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090815" CDS 34..549 /gene="LOC106090815" /codon_start=1 /product="uncharacterized protein LOC106090815" /protein_id="XP_013112587.2" /db_xref="GeneID:106090815" /translation="MPFSCLTLPLFIIKISSLMLFIAAFTLKTWDIATLYGQFNSHCI AGWEITDKVGPHLMLIMMSWMPDLAFIVCIGIGMAFEKCNMGTDPGTIAYNVIVGISC LCSMFYITAIEDCGNDAIPIVKGVALLSALAGALHLINGAVCLIFLPPEERKIRARRP QNSETSSLAAL" ORIGIN 1 tattcctcat tcttttaaac aaacgttaaa accatgccgt tcagttgtct cacattgccg 61 ctttttatta tcaaaattag cagcttgatg ttattcattg cagccttcac cttgaaaact 121 tgggatattg caactctcta tggtcaattc aattcacatt gtatagccgg ttgggagata 181 acggataaag tgggtcccca cttgatgctg attatgatgt cttggatgcc ggatttggcg 241 tttatagtat gcattggaat tggcatggcc tttgaaaagt gtaatatggg aacagatcca 301 gggaccatag cttataatgt tatagtgggc ataagttgcc tgtgctccat gttctatata 361 acggccattg aggattgtgg aaatgacgcc attcccattg tgaagggtgt tgctttgcta 421 agcgctttag ctggagcatt gcatttgatc aatggtgctg tatgtcttat ttttctccca 481 ccagaggaaa gaaagattcg agcaaggaga cctcaaaact cggagacatc ttcattagca 541 gcattgtaaa ttagaaaaat tgcactaaaa tctaccatct ccctaatgct actgagatta 601 tattgaggct agctaaattt aaatgatccg tcttttagca ctggactaca tgttgtcaac 661 a