Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090815


LOCUS       XM_013257133             661 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090815), mRNA.
ACCESSION   XM_013257133
VERSION     XM_013257133.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257133.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..661
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..661
                     /gene="LOC106090815"
                     /note="uncharacterized LOC106090815; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090815"
     CDS             34..549
                     /gene="LOC106090815"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090815"
                     /protein_id="XP_013112587.2"
                     /db_xref="GeneID:106090815"
                     /translation="MPFSCLTLPLFIIKISSLMLFIAAFTLKTWDIATLYGQFNSHCI
                     AGWEITDKVGPHLMLIMMSWMPDLAFIVCIGIGMAFEKCNMGTDPGTIAYNVIVGISC
                     LCSMFYITAIEDCGNDAIPIVKGVALLSALAGALHLINGAVCLIFLPPEERKIRARRP
                     QNSETSSLAAL"
ORIGIN      
        1 tattcctcat tcttttaaac aaacgttaaa accatgccgt tcagttgtct cacattgccg
       61 ctttttatta tcaaaattag cagcttgatg ttattcattg cagccttcac cttgaaaact
      121 tgggatattg caactctcta tggtcaattc aattcacatt gtatagccgg ttgggagata
      181 acggataaag tgggtcccca cttgatgctg attatgatgt cttggatgcc ggatttggcg
      241 tttatagtat gcattggaat tggcatggcc tttgaaaagt gtaatatggg aacagatcca
      301 gggaccatag cttataatgt tatagtgggc ataagttgcc tgtgctccat gttctatata
      361 acggccattg aggattgtgg aaatgacgcc attcccattg tgaagggtgt tgctttgcta
      421 agcgctttag ctggagcatt gcatttgatc aatggtgctg tatgtcttat ttttctccca
      481 ccagaggaaa gaaagattcg agcaaggaga cctcaaaact cggagacatc ttcattagca
      541 gcattgtaaa ttagaaaaat tgcactaaaa tctaccatct ccctaatgct actgagatta
      601 tattgaggct agctaaattt aaatgatccg tcttttagca ctggactaca tgttgtcaac
      661 a