Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013257008             543 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090725), mRNA.
ACCESSION   XM_013257008
VERSION     XM_013257008.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257008.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..543
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..543
                     /gene="LOC106090725"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090725"
     CDS             14..526
                     /gene="LOC106090725"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013112462.2"
                     /db_xref="GeneID:106090725"
                     /translation="MQIMNASVVLLLTTMGFMFNMSFGAMWHEAGDGRRYLVEGTAKY
                     NWLQALDQCLLKGLQLVVIDSAAKNEELVKLLRSIFGNSRDLWIGHHDEFNKKGGASR
                     NWYSAAIGEPIFFGYWDRGEPNNRFGEHCAQIYRKSNFRWNDENCDTHFFGYICEKAN
                     KTDLDQPDIQ"
     polyA_site      543
                     /gene="LOC106090725"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctcattcgta gaaatgcaga tcatgaacgc aagtgttgtg ttgctactca caactatggg
       61 gttcatgttc aatatgtcct ttggggctat gtggcacgag gctggcgatg gacgtcgtta
      121 cttggtcgag gggactgcaa aatataactg gctccaggct ttggatcaat gtttactcaa
      181 aggattacaa ctggtggtaa ttgacagtgc ggcaaaaaat gaagagttgg ttaagctgtt
      241 gcgttcaata tttggcaatt ctcgtgactt atggataggt catcatgatg aattcaataa
      301 aaaaggtggt gcatctcgca actggtattc agccgcaata ggtgaaccga tattctttgg
      361 gtattgggat cgcggcgaac ccaacaacag atttggtgaa cactgtgctc aaatctatag
      421 aaaatcgaat tttagatgga acgacgaaaa ctgtgatacc catttcttcg gttatatctg
      481 tgagaaggct aataaaactg atctagatca acctgatata caataaaaaa atcgatgatt
      541 ggc