PREDICTED: Stomoxys calcitrans lectin subunit alpha-like

LOCUS       XM_013257006             552 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090723), mRNA.
ACCESSION   XM_013257006
VERSION     XM_013257006.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257006.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..552
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..552
                     /gene="LOC106090723"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090723"
     CDS             1..474
                     /gene="LOC106090723"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013112460.1"
                     /db_xref="GeneID:106090723"
                     /translation="MLAKSFVLFVGLFQLASAAYWYKANDGNEYFIEASTNYNWLQAM
                     DQCSRQGLQLVTIDHPSKNAALTTLLRSIFNSSPDLWIGHHDEFNTKSDKYRSWYTPY
                     TGSSISFSYWGNHQPDNTNGGEHCAHIFRKADFKWNDGRCEAKFGFICERPHQSR"
     misc_feature    103..456
                     /gene="LOC106090723"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(370..372,382..384,388..390,406..408,412..423,
                     430..438)
                     /gene="LOC106090723"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
ORIGIN      
        1 atgttggcaa aaagctttgt tctgtttgta gggctgtttc aattggcttc ggcagcttat
       61 tggtataagg caaatgatgg aaatgagtat ttcattgaag cttcgaccaa ttacaattgg
      121 cttcaggcaa tggatcaatg ctccagacaa ggattacagc ttgtcacaat tgaccatcca
      181 tcaaagaatg cggctctaac aacacttttg cgttcaattt ttaatagttc accggatttg
      241 tggataggtc accatgatga attcaataca aagagcgata aatatcgctc ttggtacact
      301 ccttataccg gttcatcgat ttcctttagc tactggggca atcatcagcc agacaataca
      361 aacggcggag aacactgtgc gcatatattt cgtaaggctg atttcaaatg gaacgatgga
      421 agatgtgagg ctaagtttgg ttttatatgt gagagacccc accagagccg ttgaagccat
      481 tgatccattg gctgcggaca cataaatgat atagcgaaca tgtacgtgaa actatgccca
      541 aatttttgaa aa