Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257005 741 bp mRNA linear INV 02-SEP-2023 (LOC106090722), mRNA. ACCESSION XM_013257005 VERSION XM_013257005.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257005.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..741 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..741 /gene="LOC106090722" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106090722" CDS 23..670 /gene="LOC106090722" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013112459.2" /db_xref="GeneID:106090722" /translation="MTNVAKGVVLVIGLFQLVSSGSWHTANDGRDYFVETGRGYNWFQ AMDECSRRGLHLAVIDSEEKNFGLVRLLGKVFDPVVNLWIGHHDELNKKKDKNRNWYS VSTGKIINFKFWASGEPNNLFGKEHCVHIYKSKDFKWNDRSCDYSYGYICERSTNRTE IPDEVTTVPCPGYPPCTSSPPCPGYTPSPTGVVGNLSPRPSQSHYASGNTPTYNH" ORIGIN 1 tactattcat cctgcaagtg aaatgaccaa cgttgctaaa ggtgtcgttt tggtgattgg 61 acttttccaa ttagtctctt caggttcttg gcatacggca aacgatggac gggactactt 121 tgtagagact ggaagaggtt acaattggtt ccaggcaatg gatgaatgta gccgtcgagg 181 tttacatttg gcggttattg atagtgaaga aaaaaatttt ggtttggtta gacttttggg 241 taaagtgttt gaccctgtgg ttaatttatg gataggccat cacgatgaac tcaacaaaaa 301 gaaagacaaa aatcgcaatt ggtactctgt gtcgaccggc aaaataatta atttcaagtt 361 ttgggcttct ggtgaaccca acaacttgtt cggaaaagaa cactgtgtac atatatacaa 421 aagtaaagat ttcaagtgga atgataggtc atgtgattac tcgtatggtt atatttgtga 481 aaggagtaca aaccgtaccg aaatacctga cgaggtgaca actgtacctt gccctggcta 541 tccgccttgt actagctcac cgccttgtcc tggctatacc ccttccccaa ccggggtagt 601 gggtaactta agtccacgcc cttctcaaag ccattacgct tctggaaata ctcctactta 661 caaccactaa ccgtactcct ggtcttaaaa tattataaat aattaattaa taaacaaagt 721 gacgatttag ataatcgtta t