Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013257005             741 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090722), mRNA.
ACCESSION   XM_013257005
VERSION     XM_013257005.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257005.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..741
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..741
                     /gene="LOC106090722"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106090722"
     CDS             23..670
                     /gene="LOC106090722"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013112459.2"
                     /db_xref="GeneID:106090722"
                     /translation="MTNVAKGVVLVIGLFQLVSSGSWHTANDGRDYFVETGRGYNWFQ
                     AMDECSRRGLHLAVIDSEEKNFGLVRLLGKVFDPVVNLWIGHHDELNKKKDKNRNWYS
                     VSTGKIINFKFWASGEPNNLFGKEHCVHIYKSKDFKWNDRSCDYSYGYICERSTNRTE
                     IPDEVTTVPCPGYPPCTSSPPCPGYTPSPTGVVGNLSPRPSQSHYASGNTPTYNH"
ORIGIN      
        1 tactattcat cctgcaagtg aaatgaccaa cgttgctaaa ggtgtcgttt tggtgattgg
       61 acttttccaa ttagtctctt caggttcttg gcatacggca aacgatggac gggactactt
      121 tgtagagact ggaagaggtt acaattggtt ccaggcaatg gatgaatgta gccgtcgagg
      181 tttacatttg gcggttattg atagtgaaga aaaaaatttt ggtttggtta gacttttggg
      241 taaagtgttt gaccctgtgg ttaatttatg gataggccat cacgatgaac tcaacaaaaa
      301 gaaagacaaa aatcgcaatt ggtactctgt gtcgaccggc aaaataatta atttcaagtt
      361 ttgggcttct ggtgaaccca acaacttgtt cggaaaagaa cactgtgtac atatatacaa
      421 aagtaaagat ttcaagtgga atgataggtc atgtgattac tcgtatggtt atatttgtga
      481 aaggagtaca aaccgtaccg aaatacctga cgaggtgaca actgtacctt gccctggcta
      541 tccgccttgt actagctcac cgccttgtcc tggctatacc ccttccccaa ccggggtagt
      601 gggtaactta agtccacgcc cttctcaaag ccattacgct tctggaaata ctcctactta
      661 caaccactaa ccgtactcct ggtcttaaaa tattataaat aattaattaa taaacaaagt
      721 gacgatttag ataatcgtta t