Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013257002 424 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013257002 VERSION XM_013257002.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013257002.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..424 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..424 /gene="LOC106090719" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090719" CDS 20..274 /gene="LOC106090719" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013112456.2" /db_xref="GeneID:106090719" /translation="MNILLRNSSSILACLLAGISTLVTAIPQSYTASDGVEYVIERDQ VYNWLQAHTECVGHGLQLAIIDSAEKNQAFEALLRTIFGR" ORIGIN 1 ctcattagtc gtaggccaaa tgaatatctt attgcgaaat agttctagca ttttagcttg 61 cttgctggcg ggcatatcca cgcttgtgac agctatccca caatcctaca ccgccagtga 121 tggcgtagaa tatgtaatag aacgtgacca agtttacaat tggttacagg cccacaccga 181 gtgtgtcggt cacggtttgc agttggccat tatcgacagc gctgaaaaaa atcaagcctt 241 tgaggcatta ctacgaacaa tatttggtag gtaatttata aatgaaattc acattatgac 301 catatcgatt ctaaaatatc ttgcgggaat tgtagaatgt aaacaattgt caaaatggta 361 atacataaca aattctaaga aaatgtcccc aaaaaattat gggccataaa aaaacaccag 421 gctc