Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106090719),


LOCUS       XM_013257002             424 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013257002
VERSION     XM_013257002.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013257002.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..424
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..424
                     /gene="LOC106090719"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090719"
     CDS             20..274
                     /gene="LOC106090719"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013112456.2"
                     /db_xref="GeneID:106090719"
                     /translation="MNILLRNSSSILACLLAGISTLVTAIPQSYTASDGVEYVIERDQ
                     VYNWLQAHTECVGHGLQLAIIDSAEKNQAFEALLRTIFGR"
ORIGIN      
        1 ctcattagtc gtaggccaaa tgaatatctt attgcgaaat agttctagca ttttagcttg
       61 cttgctggcg ggcatatcca cgcttgtgac agctatccca caatcctaca ccgccagtga
      121 tggcgtagaa tatgtaatag aacgtgacca agtttacaat tggttacagg cccacaccga
      181 gtgtgtcggt cacggtttgc agttggccat tatcgacagc gctgaaaaaa atcaagcctt
      241 tgaggcatta ctacgaacaa tatttggtag gtaatttata aatgaaattc acattatgac
      301 catatcgatt ctaaaatatc ttgcgggaat tgtagaatgt aaacaattgt caaaatggta
      361 atacataaca aattctaaga aaatgtcccc aaaaaattat gggccataaa aaaacaccag
      421 gctc