PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106090716),

LOCUS       XM_013256997             579 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013256997
VERSION     XM_013256997.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256997.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 43% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..579
                     /gene="LOC106090716"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090716"
     CDS             1..579
                     /gene="LOC106090716"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013112451.2"
                     /db_xref="GeneID:106090716"
                     /translation="MLVRNISWILACLLAAISMRVTAVPQSYTAGDGTVYVVEPEAVY
                     NWLQAHTECVRQEMHLAVINNAEKNQAFDALLRQIYDTIPLLWIGHHDNLNRAETLNR
                     KFYSIVDGSEIKFTNWHTEEPNNQNYNEHCVNVGLWGDDQWNDVNCDLEIGYVCEKPR
                     ELSNVSCDLEESRKTVYELNQELSRDHENHQN"
ORIGIN      
        1 atgttagtgc gaaatatttc ttggattttg gcctgcttac ttgcagccat atccatgcgt
       61 gtgactgctg ttccccaatc ctacactgct ggtgatggca cggtgtatgt agtagaacca
      121 gaagcagttt acaattggtt gcaggcccac accgaatgtg ttagacaaga aatgcattta
      181 gccgttatca acaatgctga aaaaaaccag gcctttgacg cattactacg tcaaatatac
      241 gatacaatac cactactatg gattggtcat catgataacc ttaatagagc agaaactcta
      301 aatcgcaaat tttactcaat agtcgatgga tcggaaataa aatttaccaa ttggcatacg
      361 gaggaaccaa ataatcaaaa ctataatgaa cactgtgtca atgttggcct gtggggcgat
      421 gaccagtgga atgatgttaa ttgtgatctg gaaattggtt atgtttgcga gaaacctcga
      481 gaattatcaa atgtaagttg tgatttagaa gaaagtcgta agactgtcta cgagttaaat
      541 caagaacttt caagggatca tgaaaatcat caaaattaa