Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106090715),


LOCUS       XM_013256996             978 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013256996
VERSION     XM_013256996.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256996.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..978
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..978
                     /gene="LOC106090715"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106090715"
     CDS             18..950
                     /gene="LOC106090715"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013112450.2"
                     /db_xref="GeneID:106090715"
                     /translation="MNIPLRNLCWILACLVAGISLPVTAVPQVHIASDGTKYLIENEA
                     KYNWLQAHTECVSSDMQFAVLDSVEKNQAFVELLRQIGGKLPNLWIGHHDNFNTAEQL
                     NRRFFSIINGYEIDFNNWDKGEPNNALYSEHCVHIDSSSDFRWNDHHCENKYGYVCEE
                     PQKSTNVSCDMLDISKTVYELNQELSEDHKNHQNEVQVILNDNRLQTQNVLHEWQQSS
                     MQTLDKSQKSINEIFARKPYLSAVIADVGPSIKQIIREAYNEISQFSHEAQHAIDGNS
                     VDTQTSIMNKSEQFHEKLDENTNAVDGLLNQRGK"
ORIGIN      
        1 catttaacat agcccaaatg aatattccac tgcgaaatct ttgttggatt ttagcctgcc
       61 tagtggcagg aatatccttg cccgtgactg ctgttcctca agtgcacatt gccagtgatg
      121 gtacaaagta tttaatagaa aatgaagcaa agtataattg gttacaggcc cacaccgagt
      181 gtgtcagcag cgatatgcaa tttgccgttc tcgacagtgt cgagaaaaac caggcctttg
      241 tggaattact acgacaaatt ggcggtaaac taccaaatct atggattggc catcacgata
      301 acttcaatac tgccgaacaa ctaaatcgcc gattcttctc aataataaat ggatatgaaa
      361 tagattttaa caattgggat aagggtgaac cgaataacgc cttatactct gaacactgtg
      421 ttcacataga ttcatcgtct gactttcgat ggaatgacca ccattgtgaa aacaaatatg
      481 gttatgtttg cgaggaaccg caaaaatcta caaatgttag ctgtgatatg cttgacatta
      541 gtaaaaccgt ctacgaatta aatcaagaac tttcagagga tcataaaaat catcaaaatg
      601 aagtgcaagt aatactaaac gataatcgtc tgcaaacaca aaatgtctta cacgaatggc
      661 agcaatcttc aatgcaaact ttagataagt cgcagaaatc tattaatgag atttttgcta
      721 ggaagccata tctgagcgca gtaattgccg atgttggtcc atcaattaag cagattatcc
      781 gtgaagccta taatgaaata tcacagtttt cccatgaagc ccaacatgca atcgatggca
      841 attccgtgga tacacaaaca tctataatga acaaatctga gcaatttcat gaaaaattag
      901 atgaaaacac aaatgcagtt gatggactac tcaaccaacg tggaaagtaa gaatatctaa
      961 ggaatgacat acaatcga