Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256995 911 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013256995 VERSION XM_013256995.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256995.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 4% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..911 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..911 /gene="LOC106090714" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090714" CDS 1..888 /gene="LOC106090714" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013112449.2" /db_xref="GeneID:106090714" /translation="MHSCTATLEIRLLALVGLLHLVSGTANWHTASDGRQYLIEEAAK YNWHQAMNQCSRQGLQLVVIDNELKNEALTTLLRAVFGTSRDLWIGHHDEFNTKKDKL RNWYSMSTGEALPFNYWHSGEPNNHWGEHCAQIYGRANFHWNDADCSSKYFGYICEEH LRTTQCRANLEFKRNATNERNTQVSLDFGRTQSNVQQIMKNTRNYTDKLMVEWKIASA NILENFRNLQTIIADVGKTINDIYLKTNDDILKLAESTRLHVENTQEKGKQLINDQHA EFGEKLKKLYENVDGIFEE" ORIGIN 1 atgcatagct gcactgccac tttagagata aggctacttg cattagtggg actgcttcac 61 ttagtatctg gcaccgccaa ttggcatacg gctagcgatg gacgacaata tctaattgaa 121 gaagcggcaa agtacaattg gcatcaagca atgaaccaat gttctcgcca aggtttacaa 181 ctagtggtca tcgataatga attaaaaaat gaggctttaa caacactatt gcgtgcagtt 241 tttggcacct ctcgtgacct ctggataggc catcatgatg aattcaatac caaaaaggat 301 aaattgcgaa attggtattc catgagcacg ggggaggccc ttcccttcaa ctactggcac 361 agtggtgaac ccaataatca ttggggcgaa cattgtgctc aaatatatgg ccgtgcgaat 421 tttcattgga atgatgctga ttgtagcagc aaatattttg gctatatttg tgaagaacat 481 ctacggacta cccaatgtcg tgccaacttg gagtttaaac gaaatgccac caatgagcgc 541 aacactcaag tttcattgga ttttggtcgc acccaaagta atgtgcagca aatcatgaag 601 aataccagaa actatacgga taagcttatg gtagaatgga aaatagcttc agcaaatatt 661 ttggaaaatt ttagaaattt acaaacaatt attgccgatg ttggcaaaac gattaacgat 721 atctatttga agacgaacga tgatatattg aaattggcag agtccacacg tctgcatgtg 781 gagaacactc aagagaaagg caaacaatta attaatgatc aacatgcgga atttggtgaa 841 aaattgaaaa aactttacga aaatgttgat ggcatatttg aagaataatt atttgaaatt 901 gctcgaaagg a