Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106090714),


LOCUS       XM_013256995             911 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013256995
VERSION     XM_013256995.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256995.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 4% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..911
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..911
                     /gene="LOC106090714"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090714"
     CDS             1..888
                     /gene="LOC106090714"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013112449.2"
                     /db_xref="GeneID:106090714"
                     /translation="MHSCTATLEIRLLALVGLLHLVSGTANWHTASDGRQYLIEEAAK
                     YNWHQAMNQCSRQGLQLVVIDNELKNEALTTLLRAVFGTSRDLWIGHHDEFNTKKDKL
                     RNWYSMSTGEALPFNYWHSGEPNNHWGEHCAQIYGRANFHWNDADCSSKYFGYICEEH
                     LRTTQCRANLEFKRNATNERNTQVSLDFGRTQSNVQQIMKNTRNYTDKLMVEWKIASA
                     NILENFRNLQTIIADVGKTINDIYLKTNDDILKLAESTRLHVENTQEKGKQLINDQHA
                     EFGEKLKKLYENVDGIFEE"
ORIGIN      
        1 atgcatagct gcactgccac tttagagata aggctacttg cattagtggg actgcttcac
       61 ttagtatctg gcaccgccaa ttggcatacg gctagcgatg gacgacaata tctaattgaa
      121 gaagcggcaa agtacaattg gcatcaagca atgaaccaat gttctcgcca aggtttacaa
      181 ctagtggtca tcgataatga attaaaaaat gaggctttaa caacactatt gcgtgcagtt
      241 tttggcacct ctcgtgacct ctggataggc catcatgatg aattcaatac caaaaaggat
      301 aaattgcgaa attggtattc catgagcacg ggggaggccc ttcccttcaa ctactggcac
      361 agtggtgaac ccaataatca ttggggcgaa cattgtgctc aaatatatgg ccgtgcgaat
      421 tttcattgga atgatgctga ttgtagcagc aaatattttg gctatatttg tgaagaacat
      481 ctacggacta cccaatgtcg tgccaacttg gagtttaaac gaaatgccac caatgagcgc
      541 aacactcaag tttcattgga ttttggtcgc acccaaagta atgtgcagca aatcatgaag
      601 aataccagaa actatacgga taagcttatg gtagaatgga aaatagcttc agcaaatatt
      661 ttggaaaatt ttagaaattt acaaacaatt attgccgatg ttggcaaaac gattaacgat
      721 atctatttga agacgaacga tgatatattg aaattggcag agtccacacg tctgcatgtg
      781 gagaacactc aagagaaagg caaacaatta attaatgatc aacatgcgga atttggtgaa
      841 aaattgaaaa aactttacga aaatgttgat ggcatatttg aagaataatt atttgaaatt
      901 gctcgaaagg a