Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256994 953 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013256994 VERSION XM_013256994.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256994.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..953 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..953 /gene="LOC106090712" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106090712" CDS 27..947 /gene="LOC106090712" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013112448.1" /db_xref="GeneID:106090712" /translation="MQTLNRNFAKFGIVLFIGLFQLASTASWYTASDGHRYYIEGAAN YNWLQALDQCSRQGLQLAVIDSDSKNKALISLLRSIFGSSRDLWLGHHDEFYKKKDKN RSWYSASTGAAITFSYWDSGEPNNKGGEHCTEIYRKADFKWNDENCDTNYFGFICEEH FKTAQCRTQMETKRSTIEQKNNQLSSDFATTQDNVSQIIKGSSTDTDNTLALWENSTQ NVMDEFKQSLNELIAKKPYLQAVIGDVGPAIRALAAEAQEEISKLTQQTRQTISEIHV NGEKSVNAENNVFAGKIEDHANEMGRLLVY" misc_feature 156..500 /gene="LOC106090712" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(414..416,426..428,432..434,450..452,456..467, 474..482) /gene="LOC106090712" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" ORIGIN 1 aacagttaag aaagttagtt tgcccaatgc agaccttaaa caggaatttt gccaaatttg 61 gcattgtttt gtttattggc ctatttcaat tggcatctac tgccagttgg tatacggcca 121 gtgacggaca tcgatattat atcgagggag cagccaatta taattggctt caggcattag 181 atcagtgttc tcgtcaaggt ctacaacttg ccgtcatcga tagcgattcg aaaaataaag 241 cattgatatc tctgctgcgt tcgatatttg gtagttcccg cgacttatgg ctcggtcatc 301 atgatgaatt ctacaagaag aaggataaaa atcgtagctg gtattcagca tcaacaggtg 361 cagctatcac ctttagctac tgggacagtg gtgagcccaa caataagggt ggagaacact 421 gtaccgaaat ttatcgcaaa gccgatttta aatggaatga tgaaaattgt gatacaaatt 481 attttggttt catttgtgag gaacatttta aaaccgccca atgtcgtact caaatggaga 541 caaaacgctc gacaatagaa caaaagaaca atcaattgtc atcggatttt gccacgaccc 601 aagataatgt cagccaaatc attaaaggta gcagcacgga cacagacaat acgttagccc 661 tttgggagaa ttctacgcaa aatgttatgg atgaatttaa acaatcgctt aatgaattga 721 tagccaaaaa accctattta caggctgtca ttggtgatgt ggggccagcc ataagggcgt 781 tggctgccga agctcaggaa gagatatcga aattaacaca gcagacacgt caaacaatct 841 ctgagatcca tgtgaatggt gagaaatcag tgaatgctga aaataatgtt tttgcaggga 901 aaatcgaaga tcatgccaat gaaatgggca gattattagt ttattgaaaa ata