Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256993 488 bp mRNA linear INV 02-SEP-2023 (LOC106090711), mRNA. ACCESSION XM_013256993 VERSION XM_013256993.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256993.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..488 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..488 /gene="LOC106090711" /note="uncharacterized LOC106090711; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090711" CDS 1..474 /gene="LOC106090711" /codon_start=1 /product="uncharacterized protein LOC106090711" /protein_id="XP_013112447.2" /db_xref="GeneID:106090711" /translation="MFYTKVVCLLAAILVIAYTPAATGEGTCDDCLGKGMLELMDKLE QKRDCWFNTNHHILLRLKVINFECLLETFYAILKYNNEVIREECKREVQLNKCSMSDA DLKTICLYDNLRTVTETYNDQEQCNGAQIKSSHLTIANKLLTGVLTGLGKVHPDC" ORIGIN 1 atgttctata ctaaagttgt ttgcctatta gcagctatcc tagtcatagc ctatacacct 61 gcagccacag gagaaggcac ctgcgacgac tgtttgggaa aaggtatgct cgagctcatg 121 gacaaattgg agcagaaaag ggattgctgg ttcaatacca accatcatat cctccttaga 181 ttgaaagtta ttaatttcga atgcctattg gaaacttttt atgcgatatt gaagtacaat 241 aatgaagtca taagggagga atgcaagaga gaagtccaat taaacaaatg ttccatgagt 301 gatgcggatt tgaagacaat atgtctctat gacaatctga ggacagttac cgaaacctat 361 aacgatcagg agcagtgtaa tggtgcacaa attaaatctt cacatttgac gatagcaaac 421 aaattgctga ctggtgtact cacaggtttg ggaaaggtac atccagactg ctagaagaag 481 ttgttgtt