Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090711


LOCUS       XM_013256993             488 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090711), mRNA.
ACCESSION   XM_013256993
VERSION     XM_013256993.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256993.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..488
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..488
                     /gene="LOC106090711"
                     /note="uncharacterized LOC106090711; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090711"
     CDS             1..474
                     /gene="LOC106090711"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090711"
                     /protein_id="XP_013112447.2"
                     /db_xref="GeneID:106090711"
                     /translation="MFYTKVVCLLAAILVIAYTPAATGEGTCDDCLGKGMLELMDKLE
                     QKRDCWFNTNHHILLRLKVINFECLLETFYAILKYNNEVIREECKREVQLNKCSMSDA
                     DLKTICLYDNLRTVTETYNDQEQCNGAQIKSSHLTIANKLLTGVLTGLGKVHPDC"
ORIGIN      
        1 atgttctata ctaaagttgt ttgcctatta gcagctatcc tagtcatagc ctatacacct
       61 gcagccacag gagaaggcac ctgcgacgac tgtttgggaa aaggtatgct cgagctcatg
      121 gacaaattgg agcagaaaag ggattgctgg ttcaatacca accatcatat cctccttaga
      181 ttgaaagtta ttaatttcga atgcctattg gaaacttttt atgcgatatt gaagtacaat
      241 aatgaagtca taagggagga atgcaagaga gaagtccaat taaacaaatg ttccatgagt
      301 gatgcggatt tgaagacaat atgtctctat gacaatctga ggacagttac cgaaacctat
      361 aacgatcagg agcagtgtaa tggtgcacaa attaaatctt cacatttgac gatagcaaac
      421 aaattgctga ctggtgtact cacaggtttg ggaaaggtac atccagactg ctagaagaag
      481 ttgttgtt