Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090710


LOCUS       XM_013256992             392 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090710), mRNA.
ACCESSION   XM_013256992
VERSION     XM_013256992.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256992.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..392
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..392
                     /gene="LOC106090710"
                     /note="uncharacterized LOC106090710; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090710"
     CDS             1..390
                     /gene="LOC106090710"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090710"
                     /protein_id="XP_013112446.2"
                     /db_xref="GeneID:106090710"
                     /translation="MFPAKPVFNLKPNTHRPPIVLLQGLLDNGLGIWTLWQWLEGIGL
                     LPKIDVFTFKLKILETFYEELFRIHQQTIEFSSVECRKQNTIDVNSCQNYRYQDSCQS
                     FMPSLPQLIPKLLAGVIVKTKDSHWSY"
ORIGIN      
        1 atgttccctg ccaaacccgt attcaatttg aagcccaata ctcataggcc tccgattgta
       61 ctcttgcaag gacttctgga caacggctta ggtatttgga ccttgtggca gtggctggag
      121 ggcattggtc tactgcccaa aatcgatgtg ttcacattta aattaaagat tctggagaca
      181 ttttacgagg aattgttcag aattcatcaa caaaccatag aattttcctc agttgaatgc
      241 cgaaagcaga acaccataga tgtcaattca tgccagaact atcgctatca ggatagctgt
      301 caatcgttta tgccctcgtt gccacaattg attccaaagt tattggctgg ggttatagta
      361 aaaactaagg actcccattg gagttattaa ga