Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256992 392 bp mRNA linear INV 02-SEP-2023 (LOC106090710), mRNA. ACCESSION XM_013256992 VERSION XM_013256992.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256992.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..392 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..392 /gene="LOC106090710" /note="uncharacterized LOC106090710; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090710" CDS 1..390 /gene="LOC106090710" /codon_start=1 /product="uncharacterized protein LOC106090710" /protein_id="XP_013112446.2" /db_xref="GeneID:106090710" /translation="MFPAKPVFNLKPNTHRPPIVLLQGLLDNGLGIWTLWQWLEGIGL LPKIDVFTFKLKILETFYEELFRIHQQTIEFSSVECRKQNTIDVNSCQNYRYQDSCQS FMPSLPQLIPKLLAGVIVKTKDSHWSY" ORIGIN 1 atgttccctg ccaaacccgt attcaatttg aagcccaata ctcataggcc tccgattgta 61 ctcttgcaag gacttctgga caacggctta ggtatttgga ccttgtggca gtggctggag 121 ggcattggtc tactgcccaa aatcgatgtg ttcacattta aattaaagat tctggagaca 181 ttttacgagg aattgttcag aattcatcaa caaaccatag aattttcctc agttgaatgc 241 cgaaagcaga acaccataga tgtcaattca tgccagaact atcgctatca ggatagctgt 301 caatcgttta tgccctcgtt gccacaattg attccaaagt tattggctgg ggttatagta 361 aaaactaagg actcccattg gagttattaa ga