Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090708


LOCUS       XM_013256989             659 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090708), mRNA.
ACCESSION   XM_013256989
VERSION     XM_013256989.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256989.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..659
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..659
                     /gene="LOC106090708"
                     /note="uncharacterized LOC106090708; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090708"
     CDS             65..541
                     /gene="LOC106090708"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090708"
                     /protein_id="XP_013112443.2"
                     /db_xref="GeneID:106090708"
                     /translation="MLNIKVLLTIGALLLASVSLTSAEDSECTDCRGDILKESVQELS
                     NKSTCWFKPNNNYLLRFKYACIRGCSGVLDDLYQKTNEAASDECRQNIELPTCEESDD
                     YYAVSQCKLQQMTATAQAYKDLEQCSGQVTDTRDVDLLLKVIVGTIVGWHVVHPEC"
     polyA_site      659
                     /gene="LOC106090708"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcttgggct taaaaggctt tgttattttt cgcattggct cagaaaagtt ttgaaggtag
       61 cgaaatgttg aacatcaaag tcttgctaac aatcggagca cttttgcttg ccagtgtaag
      121 cttaacctcg gctgaagaca gtgagtgcac agattgccgt ggcgatattt taaaggaatc
      181 tgttcaagaa ttatccaaca agagcacttg ttggttcaaa ccaaacaata attatctatt
      241 gagatttaaa tatgcctgta taaggggttg ttccggagtt cttgatgacc tctatcaaaa
      301 aaccaatgag gccgccagcg atgagtgccg ccaaaacatt gaactgccca cctgtgagga
      361 atccgatgat tattacgcag tatcacaatg caaattgcaa caaatgacgg ctacagccca
      421 agcctataag gacttggaac aatgttctgg ccaagtcacc gacaccaggg atgtcgattt
      481 actactcaaa gttattgtgg gaacaatcgt tggttggcat gtggtgcatc cagaatgtta
      541 gtttctttcc cgcagcaatt gtcctgtaga aacttttgaa ttgttatagt aaacttagat
      601 tttttgtgat atggttgaat aaattataaa aatatacaga tttttagtta atatcgaaa