Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256989 659 bp mRNA linear INV 02-SEP-2023 (LOC106090708), mRNA. ACCESSION XM_013256989 VERSION XM_013256989.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256989.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..659 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..659 /gene="LOC106090708" /note="uncharacterized LOC106090708; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090708" CDS 65..541 /gene="LOC106090708" /codon_start=1 /product="uncharacterized protein LOC106090708" /protein_id="XP_013112443.2" /db_xref="GeneID:106090708" /translation="MLNIKVLLTIGALLLASVSLTSAEDSECTDCRGDILKESVQELS NKSTCWFKPNNNYLLRFKYACIRGCSGVLDDLYQKTNEAASDECRQNIELPTCEESDD YYAVSQCKLQQMTATAQAYKDLEQCSGQVTDTRDVDLLLKVIVGTIVGWHVVHPEC" polyA_site 659 /gene="LOC106090708" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gtcttgggct taaaaggctt tgttattttt cgcattggct cagaaaagtt ttgaaggtag 61 cgaaatgttg aacatcaaag tcttgctaac aatcggagca cttttgcttg ccagtgtaag 121 cttaacctcg gctgaagaca gtgagtgcac agattgccgt ggcgatattt taaaggaatc 181 tgttcaagaa ttatccaaca agagcacttg ttggttcaaa ccaaacaata attatctatt 241 gagatttaaa tatgcctgta taaggggttg ttccggagtt cttgatgacc tctatcaaaa 301 aaccaatgag gccgccagcg atgagtgccg ccaaaacatt gaactgccca cctgtgagga 361 atccgatgat tattacgcag tatcacaatg caaattgcaa caaatgacgg ctacagccca 421 agcctataag gacttggaac aatgttctgg ccaagtcacc gacaccaggg atgtcgattt 481 actactcaaa gttattgtgg gaacaatcgt tggttggcat gtggtgcatc cagaatgtta 541 gtttctttcc cgcagcaatt gtcctgtaga aacttttgaa ttgttatagt aaacttagat 601 tttttgtgat atggttgaat aaattataaa aatatacaga tttttagtta atatcgaaa