Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256987 676 bp mRNA linear INV 02-SEP-2023 (LOC106090705), mRNA. ACCESSION XM_013256987 VERSION XM_013256987.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256987.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..676 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..676 /gene="LOC106090705" /note="uncharacterized LOC106090705; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090705" CDS 58..651 /gene="LOC106090705" /codon_start=1 /product="uncharacterized protein LOC106090705" /protein_id="XP_013112441.2" /db_xref="GeneID:106090705" /translation="MAKKKIFTVAVVLAVVASLASLTQADMVEKSLMQDLANHFKRLG ATTLCAVDKFDGADVPSKVDKVIEVGVGNLRQFLGKVLSGEEYIKQSILSVKTAAIDM GGTHSKCANVSTDYIASNTPVNGSELFATGKVQLKVSENLSCVVQKGDDAALDKVPYF YAKIINNIAADESDNQVNKLIRHETTLASDLGGLASC" ORIGIN 1 gcacacaaac cagactgtgt gcattaatgg agtctatacc ccaagttaac ttttactatg 61 gctaaaaaga aaatctttac tgtggccgtt gtattggcag ttgtggcatc attggcttct 121 ttgacccaag ccgatatggt agagaagtcc ttgatgcagg atcttgccaa ccattttaag 181 cgacttggtg ctaccactct atgtgctgtt gataaattcg atggtgctga tgttcccagc 241 aaggtagaca aggtcatcga agtaggcgtg ggtaatttaa ggcaatttct gggtaaagtc 301 ttatccggtg aggaatacat taaacaatcg atacttagtg tcaagacagc cgcaatagat 361 atgggtggaa cccattcaaa atgtgcaaac gtctctaccg attatattgc cagcaatact 421 ccagttaatg gttcggaatt atttgccact ggcaaagtac agctgaaagt cagtgaaaat 481 ttatcatgcg ttgtgcaaaa gggagatgat gcagctcttg ataaggttcc atacttttat 541 gccaagatca tcaacaatat tgcggccgac gaaagtgata atcaggttaa taagttgatc 601 agacacgaaa cgacattggc cagtgatttg ggaggtttag cttcctgtta aatcgtcgga 661 gaaggaagac atttct