Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090705


LOCUS       XM_013256987             676 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090705), mRNA.
ACCESSION   XM_013256987
VERSION     XM_013256987.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256987.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..676
                     /gene="LOC106090705"
                     /note="uncharacterized LOC106090705; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090705"
     CDS             58..651
                     /gene="LOC106090705"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090705"
                     /protein_id="XP_013112441.2"
                     /db_xref="GeneID:106090705"
                     /translation="MAKKKIFTVAVVLAVVASLASLTQADMVEKSLMQDLANHFKRLG
                     ATTLCAVDKFDGADVPSKVDKVIEVGVGNLRQFLGKVLSGEEYIKQSILSVKTAAIDM
                     GGTHSKCANVSTDYIASNTPVNGSELFATGKVQLKVSENLSCVVQKGDDAALDKVPYF
                     YAKIINNIAADESDNQVNKLIRHETTLASDLGGLASC"
ORIGIN      
        1 gcacacaaac cagactgtgt gcattaatgg agtctatacc ccaagttaac ttttactatg
       61 gctaaaaaga aaatctttac tgtggccgtt gtattggcag ttgtggcatc attggcttct
      121 ttgacccaag ccgatatggt agagaagtcc ttgatgcagg atcttgccaa ccattttaag
      181 cgacttggtg ctaccactct atgtgctgtt gataaattcg atggtgctga tgttcccagc
      241 aaggtagaca aggtcatcga agtaggcgtg ggtaatttaa ggcaatttct gggtaaagtc
      301 ttatccggtg aggaatacat taaacaatcg atacttagtg tcaagacagc cgcaatagat
      361 atgggtggaa cccattcaaa atgtgcaaac gtctctaccg attatattgc cagcaatact
      421 ccagttaatg gttcggaatt atttgccact ggcaaagtac agctgaaagt cagtgaaaat
      481 ttatcatgcg ttgtgcaaaa gggagatgat gcagctcttg ataaggttcc atacttttat
      541 gccaagatca tcaacaatat tgcggccgac gaaagtgata atcaggttaa taagttgatc
      601 agacacgaaa cgacattggc cagtgatttg ggaggtttag cttcctgtta aatcgtcgga
      661 gaaggaagac atttct