Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256984 674 bp mRNA linear INV 02-SEP-2023 (LOC106090702), mRNA. ACCESSION XM_013256984 VERSION XM_013256984.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256984.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..674 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..674 /gene="LOC106090702" /note="uncharacterized LOC106090702; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090702" CDS 29..625 /gene="LOC106090702" /codon_start=1 /product="uncharacterized protein LOC106090702" /protein_id="XP_013112438.1" /db_xref="GeneID:106090702" /translation="MANKFFGATVSLWLLVTLVHVSHGELVEKSLLQAVATNNQRLGR AAQCVADLFEDAEVQTKCNTVVEGGIGFLRGYKGKTLTDEGYINLANLVIMTAVTNMQ GVHPKCASAGDSYTVSNTPSSGANLSKTGGVFVRIGDVCDCLIKKGDNDLLAKVPAFY AKIIEGLASDTGADLVDVLYKHESTLANDLASLSGDCK" ORIGIN 1 cagtgactat aacacagtgt atacagcaat ggctaataag ttcttcggtg caacagtttc 61 gttgtggttg ttggtcactt tggtccatgt aagtcatggt gagttggtgg agaaatccct 121 gctacaagct gtggccacca acaaccaacg cctgggcaga gcagcacaat gtgtagccga 181 tttgtttgaa gatgctgaag tacaaaccaa atgtaatact gtggtcgaag gaggcatagg 241 atttttgaga ggttataagg gcaaaactct gaccgatgaa gggtacataa atttggcaaa 301 tctggtcatc atgactgctg tgaccaacat gcaaggcgtt caccctaaat gtgcaagtgc 361 tggtgattcc tacactgtca gcaatacacc atcatcggga gctaatttgt ccaagactgg 421 tggagttttc gtacgcattg gtgatgtgtg cgattgtttg atcaaaaaag gcgataatga 481 tctattggct aaagttccag ctttctatgc caagatcatt gaaggacttg cttcggatac 541 tggcgctgat cttgtggatg ttctctacaa acatgagtct accttggcaa atgatttggc 601 cagtttgtct ggtgattgta aataggacaa ggattgaaag tagttcaaag aaagaggacc 661 tggtaggatc cttc