Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090702


LOCUS       XM_013256984             674 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090702), mRNA.
ACCESSION   XM_013256984
VERSION     XM_013256984.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256984.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..674
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..674
                     /gene="LOC106090702"
                     /note="uncharacterized LOC106090702; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090702"
     CDS             29..625
                     /gene="LOC106090702"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090702"
                     /protein_id="XP_013112438.1"
                     /db_xref="GeneID:106090702"
                     /translation="MANKFFGATVSLWLLVTLVHVSHGELVEKSLLQAVATNNQRLGR
                     AAQCVADLFEDAEVQTKCNTVVEGGIGFLRGYKGKTLTDEGYINLANLVIMTAVTNMQ
                     GVHPKCASAGDSYTVSNTPSSGANLSKTGGVFVRIGDVCDCLIKKGDNDLLAKVPAFY
                     AKIIEGLASDTGADLVDVLYKHESTLANDLASLSGDCK"
ORIGIN      
        1 cagtgactat aacacagtgt atacagcaat ggctaataag ttcttcggtg caacagtttc
       61 gttgtggttg ttggtcactt tggtccatgt aagtcatggt gagttggtgg agaaatccct
      121 gctacaagct gtggccacca acaaccaacg cctgggcaga gcagcacaat gtgtagccga
      181 tttgtttgaa gatgctgaag tacaaaccaa atgtaatact gtggtcgaag gaggcatagg
      241 atttttgaga ggttataagg gcaaaactct gaccgatgaa gggtacataa atttggcaaa
      301 tctggtcatc atgactgctg tgaccaacat gcaaggcgtt caccctaaat gtgcaagtgc
      361 tggtgattcc tacactgtca gcaatacacc atcatcggga gctaatttgt ccaagactgg
      421 tggagttttc gtacgcattg gtgatgtgtg cgattgtttg atcaaaaaag gcgataatga
      481 tctattggct aaagttccag ctttctatgc caagatcatt gaaggacttg cttcggatac
      541 tggcgctgat cttgtggatg ttctctacaa acatgagtct accttggcaa atgatttggc
      601 cagtttgtct ggtgattgta aataggacaa ggattgaaag tagttcaaag aaagaggacc
      661 tggtaggatc cttc