Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mitochondrial import inner membrane


LOCUS       XM_013256953             557 bp    mRNA    linear   INV 02-SEP-2023
            translocase subunit Tim8 (LOC106090674), mRNA.
ACCESSION   XM_013256953
VERSION     XM_013256953.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256953.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..557
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..557
                     /gene="LOC106090674"
                     /note="mitochondrial import inner membrane translocase
                     subunit Tim8; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 Proteins"
                     /db_xref="GeneID:106090674"
     CDS             89..358
                     /gene="LOC106090674"
                     /codon_start=1
                     /product="mitochondrial import inner membrane translocase
                     subunit Tim8"
                     /protein_id="XP_013112407.1"
                     /db_xref="GeneID:106090674"
                     /translation="MADFDSVGSSSGDSELQEFLMIEKQKAQVNAQIHEFNEICWDKC
                     IGKPGSKLDSATETCLANCVDRFIDTSLLITQRFAQMLQKNSGGM"
     misc_feature    140..328
                     /gene="LOC106090674"
                     /note="Tim10/DDP family zinc finger; Region: zf-Tim10_DDP;
                     pfam02953"
                     /db_xref="CDD:460764"
     polyA_site      557
                     /gene="LOC106090674"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 caatttgagg ttatataaaa gaaagaaata acgaaatcgc cgtgtagaaa ttagagtttc
       61 aagtaaatag aattataaaa taaataaaat ggcagatttt gattcagtcg gttcttcttc
      121 gggcgacagt gagttgcagg aatttcttat gattgaaaaa caaaaagcgc aagttaatgc
      181 acagatacac gagttcaacg agatctgttg ggacaaatgc ataggcaaac ctggttccaa
      241 attagatagt gccacagaga catgtttagc caattgtgtg gatcgtttca ttgatacatc
      301 tttgctgata acacaacggt ttgctcagat gctgcaaaag aactctggcg gaatgtaatg
      361 tacacacaca caaacacctt tacataaagt acaatacact agatggaatt cttatagtca
      421 aaatacttca tctctgcaag ttcagtaaat gatattgaag gctttcatca tattggcaaa
      481 atattttatt tagatctgat gtttttgtta ttttcttagt tgtacgcaat aaaaactact
      541 atataaaagc agactaa