Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256952 642 bp mRNA linear INV 02-SEP-2023 (LOC106090673), mRNA. ACCESSION XM_013256952 VERSION XM_013256952.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256952.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..642 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..642 /gene="LOC106090673" /note="uncharacterized LOC106090673; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106090673" CDS 91..453 /gene="LOC106090673" /codon_start=1 /product="uncharacterized protein LOC106090673" /protein_id="XP_013112406.2" /db_xref="GeneID:106090673" /translation="MTSSADTTFKDGEELFPSADELETYYNMLENGSILELDWQCPGR RPPSPDVTNASKDQNNLTETIETQEPMKTNDFDFSDDVAQPQMRARHGTPKSLKKKTA NFAGVMEALKKKNAEGSN" polyA_site 642 /gene="LOC106090673" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tatcgatgca aactctatta taaagtttgt ttacatgcat ttgtttgaaa taaacagctg 61 ggaaatttat tttttgtggg cgcacaaaga atgacttcta gcgctgatac cacttttaag 121 gatggcgaag aactctttcc ttcggcggat gagctggaaa cttactacaa catgctagaa 181 aatggtagta tcttagaatt agattggcaa tgtcccggtc gacggccacc atctcctgat 241 gtcaccaacg ccagcaagga tcagaacaac ttgactgaaa ctatagagac tcaagaacca 301 atgaagacca atgatttcga ctttagcgac gatgttgccc agcctcaaat gcgtgctcgt 361 catggaacac cgaaatcttt aaaaaagaag acagcaaatt ttgctggcgt tatggaagcc 421 ttaaaaaaga agaatgctga gggatctaac tgaccaaact agtacatgga acaagtagag 481 ctaatgatgt acaatcttgt atttaaatgt tttattatga gaaaatgttg ctgatttacg 541 gggaaaatgc atatgtatgt acatatatat ttaaatttaa ataatttgta aaaaagaaaa 601 tatgttaaac taaaccaaaa gcatttctgc ctttaattgt aa