Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090673


LOCUS       XM_013256952             642 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090673), mRNA.
ACCESSION   XM_013256952
VERSION     XM_013256952.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256952.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..642
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..642
                     /gene="LOC106090673"
                     /note="uncharacterized LOC106090673; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106090673"
     CDS             91..453
                     /gene="LOC106090673"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090673"
                     /protein_id="XP_013112406.2"
                     /db_xref="GeneID:106090673"
                     /translation="MTSSADTTFKDGEELFPSADELETYYNMLENGSILELDWQCPGR
                     RPPSPDVTNASKDQNNLTETIETQEPMKTNDFDFSDDVAQPQMRARHGTPKSLKKKTA
                     NFAGVMEALKKKNAEGSN"
     polyA_site      642
                     /gene="LOC106090673"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tatcgatgca aactctatta taaagtttgt ttacatgcat ttgtttgaaa taaacagctg
       61 ggaaatttat tttttgtggg cgcacaaaga atgacttcta gcgctgatac cacttttaag
      121 gatggcgaag aactctttcc ttcggcggat gagctggaaa cttactacaa catgctagaa
      181 aatggtagta tcttagaatt agattggcaa tgtcccggtc gacggccacc atctcctgat
      241 gtcaccaacg ccagcaagga tcagaacaac ttgactgaaa ctatagagac tcaagaacca
      301 atgaagacca atgatttcga ctttagcgac gatgttgccc agcctcaaat gcgtgctcgt
      361 catggaacac cgaaatcttt aaaaaagaag acagcaaatt ttgctggcgt tatggaagcc
      421 ttaaaaaaga agaatgctga gggatctaac tgaccaaact agtacatgga acaagtagag
      481 ctaatgatgt acaatcttgt atttaaatgt tttattatga gaaaatgttg ctgatttacg
      541 gggaaaatgc atatgtatgt acatatatat ttaaatttaa ataatttgta aaaaagaaaa
      601 tatgttaaac taaaccaaaa gcatttctgc ctttaattgt aa