Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256951 1162 bp mRNA linear INV 02-SEP-2023 (LOC106090672), mRNA. ACCESSION XM_013256951 VERSION XM_013256951.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256951.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1162 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1162 /gene="LOC106090672" /note="uncharacterized LOC106090672; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106090672" CDS 67..1035 /gene="LOC106090672" /codon_start=1 /product="uncharacterized protein LOC106090672" /protein_id="XP_013112405.2" /db_xref="GeneID:106090672" /translation="MVRKRKIPARKHHGVRDPLKQLEEKEKKLKHFVNSPPTKDNDQQ ITYKLKQFKKLTDDVKCGKKLKRIHIGVEDKPKEDKCKKDNKKDGNKFKSIKQMPGEE DVDYLRRVNRITTASLKEAQYEVKYGVKVIRDTKTGAISIKKKPTNEIDELLKQKRNG KGGGKVSKKTQQKDIKPLDPKLAKELIKQAIYEDEEEKKMEKSKNLLEYQKDVVKFGE IVHAPPALLTLPRKAEKNETVPRPGKKNNLLLKSMFRPEENSKPLPSTKKSTSSSEVT RQAMKGKRKDLPKHTRNMLENERQKLVDLYRNLKKSKGIFADKSSL" polyA_site 1162 /gene="LOC106090672" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcacaatgtg ctatcaaaac aaaaacaaac ccaaacgcat gttttaacta aaagcttgct 61 tagaaaatgg taagaaaacg taagattcct gcccggaagc atcatggagt gcgggacccg 121 ctaaagcagt tggaggagaa ggaaaaaaag ttgaaacatt tcgtaaatag cccacctaca 181 aaggataatg accagcagat cacctacaaa ctcaagcagt ttaaaaagtt aacagatgat 241 gtaaaatgtg gaaaaaaatt aaaacgcatc cacattgggg tcgaggataa gccaaaagaa 301 gataaatgca agaaggataa taaaaaggat ggaaataaat ttaaaagcat aaaacagatg 361 cccggcgaag aagacgtgga ctacttgagg cgagtgaatc gcataacgac agctagcttg 421 aaagaagcgc agtatgaagt caagtatgga gttaaagtta ttagagatac caagactggt 481 gcaatctcta taaaaaagaa accaaccaat gaaattgatg aattgctgaa gcaaaaacga 541 aatgggaaag ggggtggcaa agtgagtaag aaaactcaac agaaggacat aaaacctctg 601 gatcccaaat tagcaaaaga acttataaaa caggctatat atgaagatga ggaggaaaag 661 aagatggaaa aatccaaaaa tttattggaa tatcaaaaag atgttgtaaa atttggtgaa 721 attgttcatg ccccaccagc acttttaaca ttgccaagaa aagcagaaaa aaatgaaaca 781 gtgccaaggc ctggaaagaa aaacaactta ttgctgaagt caatgtttcg tcctgaggag 841 aattctaaac cattgccaag cacgaaaaaa tccaccagct ccagcgaggt aacaaggcaa 901 gcaatgaagg gaaaacgaaa agatctgcct aagcacacaa gaaatatgtt ggaaaatgaa 961 cgtcaaaaac tcgtagacct ttacagaaat ttaaagaaat caaaaggcat tttcgctgac 1021 aaaagttcat tgtgaatcca ggggatacag cgtcgatcat aataaaacct ttgcgttagt 1081 ctgcttttat atagtagttt ttattgcgta caactaagaa aataacaaaa acatcagatc 1141 taaataaaat attttgccaa ta