Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256947 697 bp mRNA linear INV 02-SEP-2023 domain-containing protein 1 (LOC106090669), mRNA. ACCESSION XM_013256947 VERSION XM_013256947.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256947.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..697 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..697 /gene="LOC106090669" /note="SCP2 sterol-binding domain-containing protein 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106090669" CDS 125..475 /gene="LOC106090669" /codon_start=1 /product="SCP2 sterol-binding domain-containing protein 1" /protein_id="XP_013112401.1" /db_xref="GeneID:106090669" /translation="MALGSDAIFQKMIDGIKGNEAKAKAVNGVFLYKITKDGKVVKEW TLDLKNAKVYEGPAQGVKVDTTLTVADDDMVDIGLGKLNPQAAFMKGKLKIAGNIMLT QKLAPLLQQAKANL" misc_feature 149..454 /gene="LOC106090669" /note="SCP-2 sterol transfer family; Region: SCP2; pfam02036" /db_xref="CDD:460423" polyA_site 697 /gene="LOC106090669" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tcgtaacagt agatgcctgg ttgccaagtt accaaattcc aaagtaccaa ctcaccaacc 61 acattcaacc accactcatt taatatttct cgtccaaagt tttgcatttc tacaaaacaa 121 caaaatggct cttggttccg atgcaatttt ccaaaaaatg attgatggca ttaagggcaa 181 tgaggccaaa gccaaagctg tgaacggtgt tttcttatac aaaatcacca aggatggcaa 241 agttgtcaag gaatggactt tggacttgaa gaatgctaaa gtctacgagg gacctgccca 301 aggcgttaaa gttgatacca cccttacagt cgccgatgac gatatggttg atattggctt 361 gggtaagttg aacccacaag ccgctttcat gaagggcaaa ctcaagattg ccggtaacat 421 catgttgacc caaaaattgg ctcctctatt gcaacaagct aaggctaact tgtaaaatga 481 ccacatcaca atcaactctt cgccacctgc tttagatttt ttatataata ttagaattat 541 aataattaag tatgatcaat ggtttgtctt gttgttttct ctaccaaaaa ctaaggggaa 601 ttgtatgtat gttgtataaa aattagtgat attattcttt cctcctctgt aaatgtgtaa 661 taaattgtat tttttatacc tacttaaaac tcgaaaa