Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans SCP2 sterol-binding


LOCUS       XM_013256947             697 bp    mRNA    linear   INV 02-SEP-2023
            domain-containing protein 1 (LOC106090669), mRNA.
ACCESSION   XM_013256947
VERSION     XM_013256947.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256947.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..697
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..697
                     /gene="LOC106090669"
                     /note="SCP2 sterol-binding domain-containing protein 1;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:106090669"
     CDS             125..475
                     /gene="LOC106090669"
                     /codon_start=1
                     /product="SCP2 sterol-binding domain-containing protein 1"
                     /protein_id="XP_013112401.1"
                     /db_xref="GeneID:106090669"
                     /translation="MALGSDAIFQKMIDGIKGNEAKAKAVNGVFLYKITKDGKVVKEW
                     TLDLKNAKVYEGPAQGVKVDTTLTVADDDMVDIGLGKLNPQAAFMKGKLKIAGNIMLT
                     QKLAPLLQQAKANL"
     misc_feature    149..454
                     /gene="LOC106090669"
                     /note="SCP-2 sterol transfer family; Region: SCP2;
                     pfam02036"
                     /db_xref="CDD:460423"
     polyA_site      697
                     /gene="LOC106090669"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tcgtaacagt agatgcctgg ttgccaagtt accaaattcc aaagtaccaa ctcaccaacc
       61 acattcaacc accactcatt taatatttct cgtccaaagt tttgcatttc tacaaaacaa
      121 caaaatggct cttggttccg atgcaatttt ccaaaaaatg attgatggca ttaagggcaa
      181 tgaggccaaa gccaaagctg tgaacggtgt tttcttatac aaaatcacca aggatggcaa
      241 agttgtcaag gaatggactt tggacttgaa gaatgctaaa gtctacgagg gacctgccca
      301 aggcgttaaa gttgatacca cccttacagt cgccgatgac gatatggttg atattggctt
      361 gggtaagttg aacccacaag ccgctttcat gaagggcaaa ctcaagattg ccggtaacat
      421 catgttgacc caaaaattgg ctcctctatt gcaacaagct aaggctaact tgtaaaatga
      481 ccacatcaca atcaactctt cgccacctgc tttagatttt ttatataata ttagaattat
      541 aataattaag tatgatcaat ggtttgtctt gttgttttct ctaccaaaaa ctaaggggaa
      601 ttgtatgtat gttgtataaa aattagtgat attattcttt cctcctctgt aaatgtgtaa
      661 taaattgtat tttttatacc tacttaaaac tcgaaaa