Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256944 882 bp mRNA linear INV 02-SEP-2023 (LOC106090667), transcript variant X2, mRNA. ACCESSION XM_013256944 VERSION XM_013256944.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256944.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..882 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..882 /gene="LOC106090667" /note="NAD(P)H-hydrate epimerase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins" /db_xref="GeneID:106090667" CDS 43..783 /gene="LOC106090667" /codon_start=1 /product="NAD(P)H-hydrate epimerase isoform X2" /protein_id="XP_013112398.1" /db_xref="GeneID:106090667" /translation="MFLSCVLLAIRCLTSFNAMKYLNQTEAINVDQELFNEYKFSVDQ LMELAGLSCSHAIAKCFAANEHKRVLVCCGPGNNGGDGLVCARHLSLMGYLPKVYYPK PTPNSLYENLTHQCKAMNIEFLETCPPSELLNKSYDLIVDALFGFSFKPPVREAFVPI IKALQETRLPIASIDIPSGWHVENGKNDECCFEPSLLISLTAPKLCAKLYKGPHHYLG GRFVPPALKEKYQLDLPEYPGTETCVKL" misc_feature 67..>780 /gene="LOC106090667" /note="pyridoxine (pyridoxamine) 5'-phosphate oxidase; Provisional; Region: PLN03049" /db_xref="CDD:215550" polyA_site 882 /gene="LOC106090667" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgcttttaat ttttgtgtca aattgtcaac aactttaacg gaatgttttt atcgtgcgta 61 ttattggcta ttcgctgtct tacatcattt aacgccatga aatacttgaa tcaaacagaa 121 gcaataaatg ttgatcagga actattcaac gaatataaat ttagtgttga tcaacttatg 181 gagttggccg gcttaagctg ttcccatgcc atagcaaaat gttttgcagc taatgaacat 241 aaacgcgttc tcgtctgttg tggccctggt aacaatggtg gtgatggatt ggtttgtgct 301 cggcatcttt ccctaatggg ttatttgcca aaagtgtatt atccaaaacc aacgccaaat 361 tcattatatg agaacttaac acaccagtgc aaggcaatga atatagaatt tttggaaacc 421 tgtccaccat cagagctgct caacaaatcc tacgatttaa tagtagatgc attgtttggc 481 tttagcttca agccaccggt aagggaagca tttgtgccta taattaaggc gttacaagaa 541 acaagattac ccatagccag tatcgatatt cccagtggct ggcatgttga gaatggaaaa 601 aacgacgaat gttgtttcga accaagtctt ttaatctctt taacagcacc aaaactttgt 661 gctaagttat acaaaggccc tcatcactat ttaggtggga gatttgtacc gccggcttta 721 aaggaaaagt atcaactgga cttgcccgaa tatccaggaa ccgagacatg tgtaaaattg 781 taaaaactac tcttcaaatt aaattattgc tatctatata ttatttatat atatatttac 841 aagtttgtaa taaaaatttc ataaaataac gcgaggaatt aa