Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans NAD(P)H-hydrate epimerase


LOCUS       XM_013256944             882 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090667), transcript variant X2, mRNA.
ACCESSION   XM_013256944
VERSION     XM_013256944.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256944.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..882
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..882
                     /gene="LOC106090667"
                     /note="NAD(P)H-hydrate epimerase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 15
                     Proteins"
                     /db_xref="GeneID:106090667"
     CDS             43..783
                     /gene="LOC106090667"
                     /codon_start=1
                     /product="NAD(P)H-hydrate epimerase isoform X2"
                     /protein_id="XP_013112398.1"
                     /db_xref="GeneID:106090667"
                     /translation="MFLSCVLLAIRCLTSFNAMKYLNQTEAINVDQELFNEYKFSVDQ
                     LMELAGLSCSHAIAKCFAANEHKRVLVCCGPGNNGGDGLVCARHLSLMGYLPKVYYPK
                     PTPNSLYENLTHQCKAMNIEFLETCPPSELLNKSYDLIVDALFGFSFKPPVREAFVPI
                     IKALQETRLPIASIDIPSGWHVENGKNDECCFEPSLLISLTAPKLCAKLYKGPHHYLG
                     GRFVPPALKEKYQLDLPEYPGTETCVKL"
     misc_feature    67..>780
                     /gene="LOC106090667"
                     /note="pyridoxine (pyridoxamine) 5'-phosphate oxidase;
                     Provisional; Region: PLN03049"
                     /db_xref="CDD:215550"
     polyA_site      882
                     /gene="LOC106090667"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgcttttaat ttttgtgtca aattgtcaac aactttaacg gaatgttttt atcgtgcgta
       61 ttattggcta ttcgctgtct tacatcattt aacgccatga aatacttgaa tcaaacagaa
      121 gcaataaatg ttgatcagga actattcaac gaatataaat ttagtgttga tcaacttatg
      181 gagttggccg gcttaagctg ttcccatgcc atagcaaaat gttttgcagc taatgaacat
      241 aaacgcgttc tcgtctgttg tggccctggt aacaatggtg gtgatggatt ggtttgtgct
      301 cggcatcttt ccctaatggg ttatttgcca aaagtgtatt atccaaaacc aacgccaaat
      361 tcattatatg agaacttaac acaccagtgc aaggcaatga atatagaatt tttggaaacc
      421 tgtccaccat cagagctgct caacaaatcc tacgatttaa tagtagatgc attgtttggc
      481 tttagcttca agccaccggt aagggaagca tttgtgccta taattaaggc gttacaagaa
      541 acaagattac ccatagccag tatcgatatt cccagtggct ggcatgttga gaatggaaaa
      601 aacgacgaat gttgtttcga accaagtctt ttaatctctt taacagcacc aaaactttgt
      661 gctaagttat acaaaggccc tcatcactat ttaggtggga gatttgtacc gccggcttta
      721 aaggaaaagt atcaactgga cttgcccgaa tatccaggaa ccgagacatg tgtaaaattg
      781 taaaaactac tcttcaaatt aaattattgc tatctatata ttatttatat atatatttac
      841 aagtttgtaa taaaaatttc ataaaataac gcgaggaatt aa