Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans DNA replication complex GINS protein


LOCUS       XM_013256899             785 bp    mRNA    linear   INV 02-SEP-2023
            PSF3 (LOC106090630), mRNA.
ACCESSION   XM_013256899
VERSION     XM_013256899.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256899.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..785
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..785
                     /gene="LOC106090630"
                     /note="DNA replication complex GINS protein PSF3; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 5 Proteins"
                     /db_xref="GeneID:106090630"
     CDS             58..699
                     /gene="LOC106090630"
                     /codon_start=1
                     /product="DNA replication complex GINS protein PSF3"
                     /protein_id="XP_013112353.1"
                     /db_xref="GeneID:106090630"
                     /translation="MNTQSYFPNYYAVDDLLVTQEKVECKVNTKLLKMGFLDAGADSE
                     DLNPGRSVNLPLWYIKELKVNNPYFSVCVPDIYKNVHKAVCEAETTHIELGKLHPYFY
                     EYGRYLTPYDRNHVVGKIVFETMRQRVRHLLDISKNTGEAGRPEHRLDNIENKLYEAG
                     VKTVTLYNNWLRMKFNNIAASEMVQEHTKKRKRERVSDANSDSPEQDQKRQTL"
     misc_feature    85..279
                     /gene="LOC106090630"
                     /note="beta-strand (B) domain of GINS complex protein
                     Psf3; Region: GINS_B_Psf3; cd21693"
                     /db_xref="CDD:412029"
     misc_feature    order(85..90,94..96,100..108,112..117,148..159,226..231,
                     238..243,259..261)
                     /gene="LOC106090630"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412029"
     misc_feature    259..576
                     /gene="LOC106090630"
                     /note="Alpha-helical domain of GINS complex protein Psf3
                     (partner of Sld5 3); Region: GINS_A_psf3; cd11713"
                     /db_xref="CDD:212551"
     misc_feature    order(364..366,373..375,430..432,442..444,454..459,
                     502..504,511..513,517..519,523..555)
                     /gene="LOC106090630"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212551"
ORIGIN      
        1 tattcagcgc caaaagtaaa attctactgc ggttttgtaa acaaataaat atatacaatg
       61 aatactcaaa gctattttcc caattactat gcggtggatg atttacttgt cacacaggaa
      121 aaggtggaat gtaaagtaaa cacaaaactt ttaaagatgg gtttccttga tgctggagca
      181 gactccgaag acttaaatcc tggacgctct gttaaccttc ccctctggta tattaaggaa
      241 ctcaaagtga ataatcccta tttcagcgtc tgtgttcctg atatttacaa aaatgtacac
      301 aaggcagtgt gtgaggctga aacgacacac atagaattgg gaaaacttca tccatacttc
      361 tatgaatatg ggcgctactt aacgccatac gatcgcaatc atgtggtggg aaaaattgtc
      421 tttgaaacca tgcgtcagcg agtacggcat ttattggata tctccaagaa tacgggtgaa
      481 gctggcagac cagaacatcg tttggataat attgaaaata aattgtatga agctggagtg
      541 aaaactgtaa cattgtacaa caattggctg cgaatgaaat tcaacaacat tgccgcctcc
      601 gaaatggtgc aggaacatac caaaaaacga aaacgtgaac gtgtgagtga tgctaactca
      661 gattcccccg aacaggatca aaagcggcaa acattgtagt cgtgatttac gctggtaaca
      721 ataaaacttt tattttcttt cgttaaacac aatataaggt aaacaataat gactttttaa
      781 ttctt