Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256899 785 bp mRNA linear INV 02-SEP-2023 PSF3 (LOC106090630), mRNA. ACCESSION XM_013256899 VERSION XM_013256899.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256899.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..785 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..785 /gene="LOC106090630" /note="DNA replication complex GINS protein PSF3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins" /db_xref="GeneID:106090630" CDS 58..699 /gene="LOC106090630" /codon_start=1 /product="DNA replication complex GINS protein PSF3" /protein_id="XP_013112353.1" /db_xref="GeneID:106090630" /translation="MNTQSYFPNYYAVDDLLVTQEKVECKVNTKLLKMGFLDAGADSE DLNPGRSVNLPLWYIKELKVNNPYFSVCVPDIYKNVHKAVCEAETTHIELGKLHPYFY EYGRYLTPYDRNHVVGKIVFETMRQRVRHLLDISKNTGEAGRPEHRLDNIENKLYEAG VKTVTLYNNWLRMKFNNIAASEMVQEHTKKRKRERVSDANSDSPEQDQKRQTL" misc_feature 85..279 /gene="LOC106090630" /note="beta-strand (B) domain of GINS complex protein Psf3; Region: GINS_B_Psf3; cd21693" /db_xref="CDD:412029" misc_feature order(85..90,94..96,100..108,112..117,148..159,226..231, 238..243,259..261) /gene="LOC106090630" /note="tetramer interface [polypeptide binding]; other site" /db_xref="CDD:412029" misc_feature 259..576 /gene="LOC106090630" /note="Alpha-helical domain of GINS complex protein Psf3 (partner of Sld5 3); Region: GINS_A_psf3; cd11713" /db_xref="CDD:212551" misc_feature order(364..366,373..375,430..432,442..444,454..459, 502..504,511..513,517..519,523..555) /gene="LOC106090630" /note="tetramer interface [polypeptide binding]; other site" /db_xref="CDD:212551" ORIGIN 1 tattcagcgc caaaagtaaa attctactgc ggttttgtaa acaaataaat atatacaatg 61 aatactcaaa gctattttcc caattactat gcggtggatg atttacttgt cacacaggaa 121 aaggtggaat gtaaagtaaa cacaaaactt ttaaagatgg gtttccttga tgctggagca 181 gactccgaag acttaaatcc tggacgctct gttaaccttc ccctctggta tattaaggaa 241 ctcaaagtga ataatcccta tttcagcgtc tgtgttcctg atatttacaa aaatgtacac 301 aaggcagtgt gtgaggctga aacgacacac atagaattgg gaaaacttca tccatacttc 361 tatgaatatg ggcgctactt aacgccatac gatcgcaatc atgtggtggg aaaaattgtc 421 tttgaaacca tgcgtcagcg agtacggcat ttattggata tctccaagaa tacgggtgaa 481 gctggcagac cagaacatcg tttggataat attgaaaata aattgtatga agctggagtg 541 aaaactgtaa cattgtacaa caattggctg cgaatgaaat tcaacaacat tgccgcctcc 601 gaaatggtgc aggaacatac caaaaaacga aaacgtgaac gtgtgagtga tgctaactca 661 gattcccccg aacaggatca aaagcggcaa acattgtagt cgtgatttac gctggtaaca 721 ataaaacttt tattttcttt cgttaaacac aatataaggt aaacaataat gactttttaa 781 ttctt