PREDICTED: Stomoxys calcitrans histone-lysine N-methyltransferase

LOCUS       XM_013256886             537 bp    mRNA    linear   INV 02-SEP-2023
            MECOM (LOC106090622), mRNA.
ACCESSION   XM_013256886
VERSION     XM_013256886.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256886.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..537
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..537
                     /gene="LOC106090622"
                     /note="histone-lysine N-methyltransferase MECOM; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:106090622"
     CDS             1..537
                     /gene="LOC106090622"
                     /codon_start=1
                     /product="histone-lysine N-methyltransferase MECOM"
                     /protein_id="XP_013112340.2"
                     /db_xref="GeneID:106090622"
                     /translation="MDNYSYDDYEYVDGVKRQMEKDSSANEIITPTYNIKDDIQDDMH
                     DEIHDDIRDIKEEHQRYFDESDMSHLLDYPEPGNSIDNLVYMRNEVTNLYHCDQCPLE
                     FKLLRNLRRHLLTHSDNRPFNCEFCEKTFKRKDNLQKHLRDIHSEKHFSCKACDKGFA
                     TYGQLQRHQLTQRHRKNR"
ORIGIN      
        1 atggataact acagttacga tgattacgaa tatgttgatg gtgtgaaacg gcaaatggaa
       61 aaggatagct ccgcaaatga gattattact cccacataca atataaagga tgacatacaa
      121 gacgacatgc acgacgaaat acacgacgac atacgagaca taaaagaaga acaccaacgt
      181 tattttgatg aaagtgatat gagccatttg ctggattatc ctgaaccagg aaacagcatt
      241 gataacctgg tatatatgcg caatgaggtt accaatttat atcactgcga ccagtgtcca
      301 ttggaattta aattgctgcg aaacctaagg cgacacctgc taacgcactc cgataatcgg
      361 ccatttaatt gtgaattttg tgaaaagacc tttaaacgca aggataattt gcaaaagcat
      421 ttacgtgata tacattccga aaagcatttt tcatgcaagg catgcgataa aggttttgcc
      481 acctatggcc agttacaacg acatcagcta acacaacgtc accgaaaaaa ccgatga