PREDICTED: Stomoxys calcitrans lectin subunit alpha-like

LOCUS       XM_013256844             603 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090601), mRNA.
ACCESSION   XM_013256844
VERSION     XM_013256844.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256844.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..603
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..603
                     /gene="LOC106090601"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106090601"
     CDS             1..603
                     /gene="LOC106090601"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013112298.2"
                     /db_xref="GeneID:106090601"
                     /translation="MSSAATGQQLIYGSWAPNSPNNAASKEHCVQLITNEYKWDDAQC
                     EQRYGFICEEHYLINKSDDNFSHKRDAINHKNSEIISQFEITQSKVKKSIVAAGNVSE
                     QQIDEYSKFTEENLKSFEKSLKAVFLSKPHLRVIWADIGESILELHLKLQQKQVNLAD
                     EAVEKLTEVNSNLADIVDKTNNEFYSKLKQSKYEVAEILE"
ORIGIN      
        1 atgagttcag cagctaccgg gcaacaactc atctacggtt cctgggctcc caacagtccc
       61 aacaatgcag cgtcaaagga acactgtgta caactcataa ccaatgaata caaatgggat
      121 gatgcccaat gtgaacaaag atatggtttc atatgtgaag agcattatct tatcaacaaa
      181 agtgatgata attttagtca taaacgagat gccataaatc acaaaaattc tgaaattata
      241 tcgcagtttg agatcactca gtccaaagtg aaaaaatcca ttgtggctgc tggaaatgtt
      301 tcagagcaac aaattgatga atattcaaaa ttcacagaag aaaatttgaa aagttttgag
      361 aaatctttaa aagctgtttt cttgagtaaa ccccatcttc gagtgatatg ggctgatatt
      421 ggcgaatcca tactcgagct acatttgaaa ttacagcaga agcaggttaa tctagctgat
      481 gaagccgttg aaaaattaac tgaagtcaac tcgaatcttg cagatattgt ggacaaaaca
      541 aataatgagt tttattcaaa attaaagcaa agcaaatatg aagtggcaga gattttggaa
      601 tga