Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106090600),


LOCUS       XM_013256843             638 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013256843
VERSION     XM_013256843.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256843.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..638
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..638
                     /gene="LOC106090600"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106090600"
     CDS             19..513
                     /gene="LOC106090600"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013112297.2"
                     /db_xref="GeneID:106090600"
                     /translation="MSVLGLYSLFVTLLVTFLNCVTAEPEIVTADDGTKFLIEMESKY
                     NWFEALHECGRRNYQLVEVHDGDKHNTLLKTLNTFLGKSTNLWLGANDQFSGDRDLKR
                     PFYWASSGKRMTFSHWCKDNPNNDDGEEHCVHTWEDVENFGWNDNTCTSKMGFVCEER
                     PKNC"
     polyA_site      638
                     /gene="LOC106090600"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttggtttcat ttgttaacat gagtgtattg ggattatatt cgttgtttgt tactttattg
       61 gtgacgtttt tgaattgtgt aacggcagag ccagaaatag ttactgcaga tgatggtacc
      121 aaatttttaa ttgaaatgga atcaaagtac aattggtttg aagctttaca cgaatgtggt
      181 cgccgtaatt atcaactggt tgaggtgcac gatggtgata agcacaacac tttgttaaag
      241 accttgaaca catttttagg taaatcgact aatctgtggt tgggagccaa cgaccaattc
      301 agtggtgata gagatttgaa gaggcctttt tactgggctt cctctggcaa acgcatgaca
      361 ttctcgcatt ggtgcaagga taatcccaat aacgacgatg gcgaggagca ttgtgtgcat
      421 acatgggagg atgtagaaaa ttttggttgg aatgacaata catgcactag taaaatgggc
      481 tttgtatgtg aggaaaggcc taagaattgt taataaactt gctcgatacc aaaaataaac
      541 aaaacactaa tagctttgca atcaatatga tttacaagaa aattcttcta aatgttcatt
      601 aaaccatttt aataaatgaa aactgtcaag tacaataa