Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256843 638 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013256843 VERSION XM_013256843.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256843.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..638 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..638 /gene="LOC106090600" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106090600" CDS 19..513 /gene="LOC106090600" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013112297.2" /db_xref="GeneID:106090600" /translation="MSVLGLYSLFVTLLVTFLNCVTAEPEIVTADDGTKFLIEMESKY NWFEALHECGRRNYQLVEVHDGDKHNTLLKTLNTFLGKSTNLWLGANDQFSGDRDLKR PFYWASSGKRMTFSHWCKDNPNNDDGEEHCVHTWEDVENFGWNDNTCTSKMGFVCEER PKNC" polyA_site 638 /gene="LOC106090600" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttggtttcat ttgttaacat gagtgtattg ggattatatt cgttgtttgt tactttattg 61 gtgacgtttt tgaattgtgt aacggcagag ccagaaatag ttactgcaga tgatggtacc 121 aaatttttaa ttgaaatgga atcaaagtac aattggtttg aagctttaca cgaatgtggt 181 cgccgtaatt atcaactggt tgaggtgcac gatggtgata agcacaacac tttgttaaag 241 accttgaaca catttttagg taaatcgact aatctgtggt tgggagccaa cgaccaattc 301 agtggtgata gagatttgaa gaggcctttt tactgggctt cctctggcaa acgcatgaca 361 ttctcgcatt ggtgcaagga taatcccaat aacgacgatg gcgaggagca ttgtgtgcat 421 acatgggagg atgtagaaaa ttttggttgg aatgacaata catgcactag taaaatgggc 481 tttgtatgtg aggaaaggcc taagaattgt taataaactt gctcgatacc aaaaataaac 541 aaaacactaa tagctttgca atcaatatga tttacaagaa aattcttcta aatgttcatt 601 aaaccatttt aataaatgaa aactgtcaag tacaataa