Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein SREK1IP1 (LOC106090569),


LOCUS       XM_013256804             863 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013256804
VERSION     XM_013256804.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256804.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..863
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..863
                     /gene="LOC106090569"
                     /note="protein SREK1IP1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:106090569"
     CDS             119..724
                     /gene="LOC106090569"
                     /codon_start=1
                     /product="protein SREK1IP1"
                     /protein_id="XP_013112258.1"
                     /db_xref="GeneID:106090569"
                     /translation="MSFPLTNPNKESARAACKKCGYAGHLTFQCRNFIKVDPNKEILL
                     DVESTSSDSELDYLTPLTELRMKELKEKEAELLKAKKKSAAKPKKSKKKDHKHKSKKK
                     RSSKAKKHKKRGDSKSSSSDSSSLTSSSSSDSSTESDSSDNEESSTSESDENGRKLKK
                     KGKYKRKADTPNMRRKKTKVKRRRYKTTESTSDSEEDSSSD"
     misc_feature    149..>214
                     /gene="LOC106090569"
                     /note="Zinc knuckle; Region: zf-CCHC_3; pfam13917"
                     /db_xref="CDD:404753"
     polyA_site      863
                     /gene="LOC106090569"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agctggtaat cgccacataa atttgtttat tttgctacaa agaaagccag ctaatctggc
       61 ggtcggttgt ataattgttt attaatttaa tagagcctag agaacaaatt actttaaaat
      121 gagctttccg ctgacgaatc ccaataagga gtcggccaga gcggcgtgta aaaaatgtgg
      181 ctatgccggc catctaactt ttcagtgccg caattttatc aaggtggatc cgaacaaaga
      241 gattttattg gatgttgaaa gtactagttc cgattccgaa ttggactatt tgactccatt
      301 gactgagctg cgaatgaagg agttgaaaga gaaggaggcg gagcttctaa aggcaaagaa
      361 aaaatctgct gccaagccga agaaatctaa aaagaaagac cacaagcata aaagcaaaaa
      421 gaagcgcagc agtaaagcaa agaagcataa gaaacgtggc gactccaaat cttccagttc
      481 cgattcatcc tccctaacct cgtcttcctc aagtgatagc agtaccgaat cagattctag
      541 tgacaatgag gagtcctcga caagtgaatc cgatgaaaac ggacgtaagc ttaagaagaa
      601 gggaaagtac aagcgtaagg ccgacacccc caatatgaga cgcaagaaaa ccaaggtcaa
      661 acgccgacgc tataagacca ctgaatctac cagcgactct gaagaggatt cctcttcgga
      721 ttaaagtgca gtaacaaaag aacatttttc ttagtttaaa gcctaagtag ctaattaagt
      781 acatatgtat ttaccatgta gatgatgcac atctctccga gaaagttatg tgcaccaaaa
      841 tattagtaat tgcgagtttc att