Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256804 863 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013256804 VERSION XM_013256804.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256804.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..863 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..863 /gene="LOC106090569" /note="protein SREK1IP1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:106090569" CDS 119..724 /gene="LOC106090569" /codon_start=1 /product="protein SREK1IP1" /protein_id="XP_013112258.1" /db_xref="GeneID:106090569" /translation="MSFPLTNPNKESARAACKKCGYAGHLTFQCRNFIKVDPNKEILL DVESTSSDSELDYLTPLTELRMKELKEKEAELLKAKKKSAAKPKKSKKKDHKHKSKKK RSSKAKKHKKRGDSKSSSSDSSSLTSSSSSDSSTESDSSDNEESSTSESDENGRKLKK KGKYKRKADTPNMRRKKTKVKRRRYKTTESTSDSEEDSSSD" misc_feature 149..>214 /gene="LOC106090569" /note="Zinc knuckle; Region: zf-CCHC_3; pfam13917" /db_xref="CDD:404753" polyA_site 863 /gene="LOC106090569" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agctggtaat cgccacataa atttgtttat tttgctacaa agaaagccag ctaatctggc 61 ggtcggttgt ataattgttt attaatttaa tagagcctag agaacaaatt actttaaaat 121 gagctttccg ctgacgaatc ccaataagga gtcggccaga gcggcgtgta aaaaatgtgg 181 ctatgccggc catctaactt ttcagtgccg caattttatc aaggtggatc cgaacaaaga 241 gattttattg gatgttgaaa gtactagttc cgattccgaa ttggactatt tgactccatt 301 gactgagctg cgaatgaagg agttgaaaga gaaggaggcg gagcttctaa aggcaaagaa 361 aaaatctgct gccaagccga agaaatctaa aaagaaagac cacaagcata aaagcaaaaa 421 gaagcgcagc agtaaagcaa agaagcataa gaaacgtggc gactccaaat cttccagttc 481 cgattcatcc tccctaacct cgtcttcctc aagtgatagc agtaccgaat cagattctag 541 tgacaatgag gagtcctcga caagtgaatc cgatgaaaac ggacgtaagc ttaagaagaa 601 gggaaagtac aagcgtaagg ccgacacccc caatatgaga cgcaagaaaa ccaaggtcaa 661 acgccgacgc tataagacca ctgaatctac cagcgactct gaagaggatt cctcttcgga 721 ttaaagtgca gtaacaaaag aacatttttc ttagtttaaa gcctaagtag ctaattaagt 781 acatatgtat ttaccatgta gatgatgcac atctctccga gaaagttatg tgcaccaaaa 841 tattagtaat tgcgagtttc att