Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256798 928 bp mRNA linear INV 02-SEP-2023 (LOC106090560), mRNA. ACCESSION XM_013256798 VERSION XM_013256798.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256798.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..928 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..928 /gene="LOC106090560" /note="uncharacterized LOC106090560; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106090560" CDS 85..843 /gene="LOC106090560" /codon_start=1 /product="uncharacterized protein LOC106090560" /protein_id="XP_013112252.2" /db_xref="GeneID:106090560" /translation="MAALPFIEWDVYHHLLILDVHEKQYDRVKDYIMQHYLSNELYQT LGYHEDPEFHKDLKTLIKHLLENDSSLMVLDVESDSINGIALLKCMSEEWRSWTSLQV LINNQHLKELIDFPRYSVQDYAAEQQTKWDGLHIFYYHVEPFLEANQCFMAKFFNAIA NVAKHMHMPRITYMALSRKDAALLEEMGYKEVKRILYSMYVYKGRRPFDHLRDLNEMH GSLYEFKVEPLKHFEELYPKHGLMGENVKDKKVA" polyA_site 928 /gene="LOC106090560" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tataaaactc gaaaatatac acaatattat attcaaatat aaaattttct tctcaaaaaa 61 tttccacttt tttcgtcttt tttcatggcc gctctccctt tcattgaatg ggatgtttat 121 catcatcttc ttatacttga tgtccatgag aaacaatacg atagagtcaa ggattatata 181 atgcaacatt atctctccaa tgagctgtat caaactttgg gataccatga ggatccggaa 241 ttccataaag atttaaaaac ccttatcaaa catctgttgg aaaacgatag cagtcttatg 301 gttttggatg ttgaaagtga ttccataaat ggaatagctc ttttaaaatg catgtctgaa 361 gaatggcgtt cttggacttc actacaggtg cttatcaata atcaacacct taaagaactt 421 attgattttc cacgttactc agtgcaagac tatgctgcag agcaacagac aaaatgggat 481 ggcttgcata tattttacta tcatgtggaa ccatttttag aagcaaatca atgttttatg 541 gcaaaatttt tcaatgccat tgctaatgtg gccaaacaca tgcatatgcc aagaattacc 601 tatatggcct taagtcgaaa agatgcagct cttttagagg aaatgggcta taaggaagta 661 aagcgtattc tatattccat gtatgtttat aaagggcgaa gaccctttga tcatctaaga 721 gatttaaatg aaatgcatgg ctcgttgtat gaattcaaag tggaaccttt aaaacatttt 781 gaagaattat acccaaaaca tgggttgatg ggggaaaatg tgaaggacaa gaaagttgct 841 taaaggttaa aaatactgtt gaaaaagtgc atacatcata tataaagaat tgacaataaa 901 attatgtaaa attttggttt aaagttaa