Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090560


LOCUS       XM_013256798             928 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090560), mRNA.
ACCESSION   XM_013256798
VERSION     XM_013256798.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256798.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..928
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..928
                     /gene="LOC106090560"
                     /note="uncharacterized LOC106090560; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106090560"
     CDS             85..843
                     /gene="LOC106090560"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090560"
                     /protein_id="XP_013112252.2"
                     /db_xref="GeneID:106090560"
                     /translation="MAALPFIEWDVYHHLLILDVHEKQYDRVKDYIMQHYLSNELYQT
                     LGYHEDPEFHKDLKTLIKHLLENDSSLMVLDVESDSINGIALLKCMSEEWRSWTSLQV
                     LINNQHLKELIDFPRYSVQDYAAEQQTKWDGLHIFYYHVEPFLEANQCFMAKFFNAIA
                     NVAKHMHMPRITYMALSRKDAALLEEMGYKEVKRILYSMYVYKGRRPFDHLRDLNEMH
                     GSLYEFKVEPLKHFEELYPKHGLMGENVKDKKVA"
     polyA_site      928
                     /gene="LOC106090560"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tataaaactc gaaaatatac acaatattat attcaaatat aaaattttct tctcaaaaaa
       61 tttccacttt tttcgtcttt tttcatggcc gctctccctt tcattgaatg ggatgtttat
      121 catcatcttc ttatacttga tgtccatgag aaacaatacg atagagtcaa ggattatata
      181 atgcaacatt atctctccaa tgagctgtat caaactttgg gataccatga ggatccggaa
      241 ttccataaag atttaaaaac ccttatcaaa catctgttgg aaaacgatag cagtcttatg
      301 gttttggatg ttgaaagtga ttccataaat ggaatagctc ttttaaaatg catgtctgaa
      361 gaatggcgtt cttggacttc actacaggtg cttatcaata atcaacacct taaagaactt
      421 attgattttc cacgttactc agtgcaagac tatgctgcag agcaacagac aaaatgggat
      481 ggcttgcata tattttacta tcatgtggaa ccatttttag aagcaaatca atgttttatg
      541 gcaaaatttt tcaatgccat tgctaatgtg gccaaacaca tgcatatgcc aagaattacc
      601 tatatggcct taagtcgaaa agatgcagct cttttagagg aaatgggcta taaggaagta
      661 aagcgtattc tatattccat gtatgtttat aaagggcgaa gaccctttga tcatctaaga
      721 gatttaaatg aaatgcatgg ctcgttgtat gaattcaaag tggaaccttt aaaacatttt
      781 gaagaattat acccaaaaca tgggttgatg ggggaaaatg tgaaggacaa gaaagttgct
      841 taaaggttaa aaatactgtt gaaaaagtgc atacatcata tataaagaat tgacaataaa
      901 attatgtaaa attttggttt aaagttaa