Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256749 658 bp mRNA linear INV 02-SEP-2023 (LOC106090522), mRNA. ACCESSION XM_013256749 VERSION XM_013256749.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256749.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..658 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..658 /gene="LOC106090522" /note="uncharacterized LOC106090522; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106090522" CDS 99..440 /gene="LOC106090522" /codon_start=1 /product="uncharacterized protein LOC106090522" /protein_id="XP_013112203.2" /db_xref="GeneID:106090522" /translation="MNDYKETVTEDHIKLVESINNRVNSIYKQLSEFEECIDPNTSED FGDSYNKIMDLLESLDDIQEAAQMLRPYNLNLRLRQQSLDEQIKCLEQSVHLMKLETG KMSKNPEEMGE" polyA_site 658 /gene="LOC106090522" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttacgacaa aggcaaattc caaaattcaa attttaacta taaacaaatt ggaattagtc 61 tgaaaatttg aagttgttcg aaggaaattc gagaaaatat gaacgattac aaggagactg 121 tgacagagga tcatataaaa ttggtagaaa gtataaataa tcgagtcaac agtatataca 181 aacaattatc agaatttgaa gagtgcatag atcctaacac ttccgaagac tttggtgatt 241 cttataataa aataatggac cttttggaat cactggatga catacaggaa gcggcacaaa 301 tgctaaggcc atacaatttg aatctacgcc tacgacagca atcattagat gagcaaatca 361 aatgtttgga acaatctgta catttaatga aactagaaac ggggaaaatg tcaaaaaatc 421 ccgaagaaat gggagagtaa agaatattgt ggagtctaat caactagtac atacaaggca 481 gccctcagtg tcatattcca tagagagata agacttttgc tgttacatac aactgctgtt 541 aactattgct gccagacagt gtacatttaa acaccgttct tgtaagtcta tagtagtctg 601 agattaaaaa gaaatgaact tatgcattta aatacataca tattttttta aaatgtaa