Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090522


LOCUS       XM_013256749             658 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090522), mRNA.
ACCESSION   XM_013256749
VERSION     XM_013256749.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256749.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..658
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..658
                     /gene="LOC106090522"
                     /note="uncharacterized LOC106090522; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106090522"
     CDS             99..440
                     /gene="LOC106090522"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090522"
                     /protein_id="XP_013112203.2"
                     /db_xref="GeneID:106090522"
                     /translation="MNDYKETVTEDHIKLVESINNRVNSIYKQLSEFEECIDPNTSED
                     FGDSYNKIMDLLESLDDIQEAAQMLRPYNLNLRLRQQSLDEQIKCLEQSVHLMKLETG
                     KMSKNPEEMGE"
     polyA_site      658
                     /gene="LOC106090522"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttacgacaa aggcaaattc caaaattcaa attttaacta taaacaaatt ggaattagtc
       61 tgaaaatttg aagttgttcg aaggaaattc gagaaaatat gaacgattac aaggagactg
      121 tgacagagga tcatataaaa ttggtagaaa gtataaataa tcgagtcaac agtatataca
      181 aacaattatc agaatttgaa gagtgcatag atcctaacac ttccgaagac tttggtgatt
      241 cttataataa aataatggac cttttggaat cactggatga catacaggaa gcggcacaaa
      301 tgctaaggcc atacaatttg aatctacgcc tacgacagca atcattagat gagcaaatca
      361 aatgtttgga acaatctgta catttaatga aactagaaac ggggaaaatg tcaaaaaatc
      421 ccgaagaaat gggagagtaa agaatattgt ggagtctaat caactagtac atacaaggca
      481 gccctcagtg tcatattcca tagagagata agacttttgc tgttacatac aactgctgtt
      541 aactattgct gccagacagt gtacatttaa acaccgttct tgtaagtcta tagtagtctg
      601 agattaaaaa gaaatgaact tatgcattta aatacataca tattttttta aaatgtaa