PREDICTED: Stomoxys calcitrans elongation of very long chain fatty

LOCUS       XM_013256546            1065 bp    mRNA    linear   INV 02-SEP-2023
            acids protein 7-like (LOC106090378), transcript variant X1, mRNA.
ACCESSION   XM_013256546
VERSION     XM_013256546.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256546.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1065
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1065
                     /gene="LOC106090378"
                     /note="elongation of very long chain fatty acids protein
                     7-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:106090378"
     CDS             98..922
                     /gene="LOC106090378"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein 7-like isoform X1"
                     /protein_id="XP_013112000.2"
                     /db_xref="GeneID:106090378"
                     /translation="MKVLRLTVIPILDAVNTFRLDKRVSTHPVWGSPWCMIIGVILYL
                     LVVKKWGPRFMANRKPYKIENIMMAYNCIQIIINLYIFCVSLRYSFLRSDFSWTCEPY
                     NPNDMRPETLKLGHAGRLYLFTKYLDLLDTIFFLMRKKYNQITFLHLYHHSLVLVMVH
                     VYCSKYFASHLTSTGVLNSFVHAVMYFYYQLSAMKLNINLQPWKRVMTNMQMLQFFLL
                     SVHFCLPLINNSCNFDLAFLTLTFLQNVFVTILFGNFYYQSYIRKDRKSVNIKLSS"
     polyA_site      1065
                     /gene="LOC106090378"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcataacac gagtgccgtg aaaaagtctt caggaagaat agcccatatc gattaacaac
       61 tgaatttgca gtggatattt tattttaacg ggtcaccatg aaagttctac gcttaacagt
      121 cattccaata ctggacgctg tgaatacatt tcgattagat aaacgtgttt ctacacatcc
      181 cgtatggggt agtccttggt gtatgattat tggagttatt ctatatctgt tggtggtcaa
      241 gaaatgggga cctcgtttta tggcaaatcg taagccatat aagattgaga acatcatgat
      301 ggcatacaat tgcatacaaa ttatcatcaa cttgtatatc ttttgtgttt cattgcgcta
      361 ctctttcttg cggtctgatt tcagctggac ttgtgagcca tacaacccta atgacatgag
      421 accggaaaca ttaaagctgg gacatgcggg gaggttgtac cttttcacaa aatacttgga
      481 tttattggat acgatattct ttttgatgcg caagaagtac aatcagataa cctttttgca
      541 tctgtatcat cactcacttg tgttggttat ggtgcatgtg tattgttcca aatatttcgc
      601 ttcccattta acttcaaccg gagtcctcaa ttcctttgta cacgctgtga tgtattttta
      661 ttatcaatta tcggctatga aattgaatat caacttgcag ccatggaaac gtgtaatgac
      721 caacatgcaa atgcttcaat tcttcttact ttctgttcat ttttgtttac ctctgataaa
      781 taattcgtgt aattttgact tggccttcct tacactgact tttctgcaaa atgttttcgt
      841 gactattctc tttggtaatt tctattatca gtcatacata cgcaaggatc gaaagagtgt
      901 taacattaag ttgtcatctt aaatgcagtg aatttagaaa ttcttaaaaa aacaaatgtg
      961 gaatattatt aggaatgtga agattataaa aaacaaacaa attgtagaaa atttaaaaag
     1021 aaataacaaa taaaagagtg ccaagttcgg ccagatcgaa tctta