PREDICTED: Stomoxys calcitrans elongation of very long chain fatty

LOCUS       XM_013256544             714 bp    mRNA    linear   INV 02-SEP-2023
            acids protein 1-like (LOC106090377), mRNA.
ACCESSION   XM_013256544
VERSION     XM_013256544.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256544.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 74% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..714
                     /gene="LOC106090377"
                     /note="elongation of very long chain fatty acids protein
                     1-like; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins"
                     /db_xref="GeneID:106090377"
     CDS             1..714
                     /gene="LOC106090377"
                     /codon_start=1
                     /product="elongation of very long chain fatty acids
                     protein 1-like"
                     /protein_id="XP_013111998.2"
                     /db_xref="GeneID:106090377"
                     /translation="MVTTICLYIYTVLKIGPRFMANRKPYKIDGLMQIYNVVQILLNS
                     FIFYEFFCNTILRSDFSLTCEAYNPEDMRPETMKLARPVILYAVSKYLDWFDTIFFLL
                     RKKFNQISFLHVYHHSIMVVAIYIYSSKCFAAQGTCTGLVNSFIHIVMYLYYLVSASK
                     PNIDLLPWKKLLTQMQLLQFCLVAVQFGLPLINNWCGLNELGLWIVFLQNLFMIALFS
                     NFYYKAYIRPTKKTETKAQ"
ORIGIN      
        1 atggtaacaa caatatgttt gtatatctac acagtgttga agattggccc acgcttcatg
       61 gcgaaccgaa agccctacaa aatcgatggt ctaatgcaaa tctataatgt tgtacaaatt
      121 ttattgaatt cttttatatt ctatgaattc ttttgcaaca ccattttgag atccgatttt
      181 agtttgacct gtgaagcata taatccagag gatatgagac cagaaacaat gaaattggca
      241 agacctgtta tactatacgc tgtgtcaaaa tatttggatt ggtttgatac gatcttcttt
      301 ttgttgcgta aaaagttcaa tcaaattagt ttcctgcatg tctatcatca ttccataatg
      361 gttgtagcca tctacattta ttcatcgaaa tgttttgctg cccaaggtac ctgcacaggt
      421 ttggtgaatt ctttcatcca tattgtcatg tatctgtatt atctggtgtc agcctcaaag
      481 cccaatatcg atttactacc atggaaaaaa ttactaactc aaatgcagtt gttgcaattt
      541 tgccttgtgg ccgtacaatt tggtctgccc ttaattaata attggtgtgg cctaaacgag
      601 ctgggattgt ggattgtctt tttgcaaaat ttgtttatga tagccttatt ttcaaatttc
      661 tattacaaag cttatatacg acctacaaag aaaacagaaa cgaaagcgca ataa