Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256542 543 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013256542 VERSION XM_013256542.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256542.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..543 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..543 /gene="LOC106090376" /note="protein singles bar; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106090376" CDS 13..543 /gene="LOC106090376" /codon_start=1 /product="protein singles bar" /protein_id="XP_013111996.1" /db_xref="GeneID:106090376" /translation="MSSFGVRGMSQQFGIRICCCRVCTCINFGFVTSKAGILKMLQLG LATLCEGLLIRYGMPAADTIGQPLMGFLTTTSYCFTTVAILLACYCFSEKSFGLIRQS LFETLFNGIACSMYFSASSYMGFACVVWLHPQFLIKPGFWAYPAMTAAYYIGYAAGLL HGIDAYLAFKHYKGYR" misc_feature 100..513 /gene="LOC106090376" /note="Membrane-associating domain; Region: MARVEL; pfam01284" /db_xref="CDD:366555" ORIGIN 1 aaaacattgc aaatgtcttc atttggagtt cgcggtatga gccaacaatt tggcatacgg 61 atttgttgtt gtcgcgtgtg cacctgtata aattttggat ttgtcacctc caaggcggga 121 atattgaaaa tgcttcaatt gggtttagcg actttgtgtg agggcttact catcagatat 181 ggcatgcccg ccgcagatac cattggtcag cctttaatgg gatttttgac tacaacttca 241 tattgtttta ccacggtggc aatattactg gcctgttatt gcttttcgga aaaatctttt 301 ggtcttatac gacaatcgtt atttgaaaca ctattcaatg gcattgcttg cagcatgtat 361 ttcagtgctt ctagttatat gggatttgct tgtgtggtat ggttgcatcc acaatttcta 421 atcaaaccag gattttgggc atatccagca atgactgcag cctattatat aggatatgcc 481 gctgggttat tgcatggaat cgatgcctat ttagccttca aacattacaa aggctatcga 541 taa