Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein singles bar (LOC106090376),


LOCUS       XM_013256542             543 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013256542
VERSION     XM_013256542.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256542.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..543
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..543
                     /gene="LOC106090376"
                     /note="protein singles bar; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106090376"
     CDS             13..543
                     /gene="LOC106090376"
                     /codon_start=1
                     /product="protein singles bar"
                     /protein_id="XP_013111996.1"
                     /db_xref="GeneID:106090376"
                     /translation="MSSFGVRGMSQQFGIRICCCRVCTCINFGFVTSKAGILKMLQLG
                     LATLCEGLLIRYGMPAADTIGQPLMGFLTTTSYCFTTVAILLACYCFSEKSFGLIRQS
                     LFETLFNGIACSMYFSASSYMGFACVVWLHPQFLIKPGFWAYPAMTAAYYIGYAAGLL
                     HGIDAYLAFKHYKGYR"
     misc_feature    100..513
                     /gene="LOC106090376"
                     /note="Membrane-associating domain; Region: MARVEL;
                     pfam01284"
                     /db_xref="CDD:366555"
ORIGIN      
        1 aaaacattgc aaatgtcttc atttggagtt cgcggtatga gccaacaatt tggcatacgg
       61 atttgttgtt gtcgcgtgtg cacctgtata aattttggat ttgtcacctc caaggcggga
      121 atattgaaaa tgcttcaatt gggtttagcg actttgtgtg agggcttact catcagatat
      181 ggcatgcccg ccgcagatac cattggtcag cctttaatgg gatttttgac tacaacttca
      241 tattgtttta ccacggtggc aatattactg gcctgttatt gcttttcgga aaaatctttt
      301 ggtcttatac gacaatcgtt atttgaaaca ctattcaatg gcattgcttg cagcatgtat
      361 ttcagtgctt ctagttatat gggatttgct tgtgtggtat ggttgcatcc acaatttcta
      421 atcaaaccag gattttgggc atatccagca atgactgcag cctattatat aggatatgcc
      481 gctgggttat tgcatggaat cgatgcctat ttagccttca aacattacaa aggctatcga
      541 taa