PREDICTED: Stomoxys calcitrans uncharacterized LOC106090372

LOCUS       XM_013256535             758 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090372), mRNA.
ACCESSION   XM_013256535
VERSION     XM_013256535.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256535.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..758
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..758
                     /gene="LOC106090372"
                     /note="uncharacterized LOC106090372; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106090372"
     CDS             58..636
                     /gene="LOC106090372"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090372"
                     /protein_id="XP_013111989.1"
                     /db_xref="GeneID:106090372"
                     /translation="MKLLRNCQIQVLILNFCIGIVISQYGQHTWEYELVSIDHYTSDA
                     DLLLFYELNATRVSRGVYACAGTIFFNYDVVEGDSNEIEIKTYRSDSINGDYKPIPFT
                     LQRQHIFGFMNDFYKNALMETLKDCSNLPLFDGDFVPPLEKRNYTMDNCVFTQKGFPQ
                     HLQDGYYKVVLYTFGDVEWSMIFYLLVQNIFR"
     misc_feature    301..564
                     /gene="LOC106090372"
                     /note="Protein of unknown function (DUF1091); Region:
                     DUF1091; pfam06477"
                     /db_xref="CDD:461928"
     polyA_site      758
                     /gene="LOC106090372"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tataaattga aatttcataa ttcaaactca ttcaaattaa aaaattccgt tgttgaaatg
       61 aaattgctca gaaactgtca aatacaagtt ttgatactta atttttgcat tggcattgta
      121 atatcccaat atggccagca tacgtgggaa tacgagcttg tctcaattga tcattatacc
      181 tctgatgcag atttactgct gttctatgaa ttgaatgcga cacgagtcag tcgtggagtt
      241 tatgcatgtg caggaacgat ttttttcaat tatgacgtag tagaaggtga ttccaatgag
      301 atagaaataa aaacgtaccg aagtgacagc ataaacggcg attataagcc catacccttc
      361 actttacaaa ggcagcatat ttttggtttt atgaacgatt tctacaagaa tgcattgatg
      421 gaaacattaa aggattgttc gaatttgccg ttgttcgatg gggattttgt gccaccgcta
      481 gagaagagaa attacacaat ggacaattgt gtttttaccc aaaagggatt tccccaacat
      541 ttgcaggatg gttactataa ggttgtcctt tataccttcg gtgatgttga gtggtcaatg
      601 attttttatt tattagttca aaacattttt cgatagattt ggtatctatc gaaaaacgta
      661 cgttgtgcat agattgattt tgtataaatt caacaacaaa tttaaagttt aaaaatgttc
      721 tccaaagggg aaatctaata tatttcgtcg aagctaaa