Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256534 654 bp mRNA linear INV 02-SEP-2023 (LOC106090371), mRNA. ACCESSION XM_013256534 VERSION XM_013256534.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256534.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..654 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..654 /gene="LOC106090371" /note="uncharacterized LOC106090371; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106090371" CDS 64..639 /gene="LOC106090371" /codon_start=1 /product="uncharacterized protein LOC106090371" /protein_id="XP_013111988.2" /db_xref="GeneID:106090371" /translation="MCPYSKFCWIFGFQIALLAIGTNSYGRRKTWTFEIQSVETTTSD PNIIDLELAVERVSRGVYAISGAFDLKTDVVEGDNNQVEALVYRSSDGVEEYKPIPFK MTRQHVYDAFNGYYKDMLMDTLKDCSDLPVFKDKITPPIEKKLYTLTQCQFTRDGFAD HVATGFYKVVLYGTGECDWGITVIAKVEPDI" ORIGIN 1 gtttcatagc cattctctga aagagtgttg acagtttgcc ttcgttgcga aaaaattagc 61 acgatgtgcc cttattccaa gttttgctgg attttcggtt tccaaattgc actgctggca 121 atagggacga attcatacgg cagaaggaaa acatggacgt ttgaaattca gtctgttgaa 181 acaacaacat ctgaccccaa tataattgat ttggagttgg cagtagaacg agtctcacgt 241 ggagtttatg ccatttcggg agcatttgac ttaaaaacag acgtcgttga gggcgataac 301 aatcaggtcg aagccctagt atatcgcagt agcgatggtg tagaagagta taaacccatc 361 ccttttaaaa tgactcgcca acatgtatac gatgccttta acggttacta caaggacatg 421 ttaatggata cccttaaaga ttgctccgat ttgcccgttt tcaaggacaa aattactcct 481 cctatagaaa agaaactcta tacgctaaca caatgtcaat ttacccgcga cggttttgcc 541 gatcacgtgg cgacaggatt ctacaaagtc gttttgtacg gaactgggga atgtgattgg 601 ggaatcactg ttattgctaa agtcgaaccg gatatttaaa tgattctttt tcat