Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090371


LOCUS       XM_013256534             654 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090371), mRNA.
ACCESSION   XM_013256534
VERSION     XM_013256534.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256534.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..654
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..654
                     /gene="LOC106090371"
                     /note="uncharacterized LOC106090371; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106090371"
     CDS             64..639
                     /gene="LOC106090371"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090371"
                     /protein_id="XP_013111988.2"
                     /db_xref="GeneID:106090371"
                     /translation="MCPYSKFCWIFGFQIALLAIGTNSYGRRKTWTFEIQSVETTTSD
                     PNIIDLELAVERVSRGVYAISGAFDLKTDVVEGDNNQVEALVYRSSDGVEEYKPIPFK
                     MTRQHVYDAFNGYYKDMLMDTLKDCSDLPVFKDKITPPIEKKLYTLTQCQFTRDGFAD
                     HVATGFYKVVLYGTGECDWGITVIAKVEPDI"
ORIGIN      
        1 gtttcatagc cattctctga aagagtgttg acagtttgcc ttcgttgcga aaaaattagc
       61 acgatgtgcc cttattccaa gttttgctgg attttcggtt tccaaattgc actgctggca
      121 atagggacga attcatacgg cagaaggaaa acatggacgt ttgaaattca gtctgttgaa
      181 acaacaacat ctgaccccaa tataattgat ttggagttgg cagtagaacg agtctcacgt
      241 ggagtttatg ccatttcggg agcatttgac ttaaaaacag acgtcgttga gggcgataac
      301 aatcaggtcg aagccctagt atatcgcagt agcgatggtg tagaagagta taaacccatc
      361 ccttttaaaa tgactcgcca acatgtatac gatgccttta acggttacta caaggacatg
      421 ttaatggata cccttaaaga ttgctccgat ttgcccgttt tcaaggacaa aattactcct
      481 cctatagaaa agaaactcta tacgctaaca caatgtcaat ttacccgcga cggttttgcc
      541 gatcacgtgg cgacaggatt ctacaaagtc gttttgtacg gaactgggga atgtgattgg
      601 ggaatcactg ttattgctaa agtcgaaccg gatatttaaa tgattctttt tcat