Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256377 954 bp mRNA linear INV 02-SEP-2023 (LOC106090244), mRNA. ACCESSION XM_013256377 VERSION XM_013256377.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256377.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..954 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..954 /gene="LOC106090244" /note="uncharacterized LOC106090244; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106090244" CDS 93..623 /gene="LOC106090244" /codon_start=1 /product="uncharacterized protein LOC106090244" /protein_id="XP_013111831.1" /db_xref="GeneID:106090244" /translation="MQKLVIVFLVIGLTAASPHHHKSKKALVGVGVGAGAGLGLGVGL DLGLGLGAGAGVGAGAGRDSSSSEEHGCDRCGHKHRHRDHHGGGNSGEGHFNVQTPPG SVGGGYGGGGGGGFGSGGGFGGGFGGGSGGGYGGGAGFGGGHGYDGGNGHGSSSGSFA TSSAQASSSSGSYSHG" ORIGIN 1 tttatccaga caatcgaata aaacggagta gataagagta taaaatttcc ttaaaaacct 61 ccgaacgcat tgcatcgaaa aggattattg caatgcaaaa attggtgatt gtgtttttgg 121 ttataggcct gactgctgct tccccgcatc atcacaaatc gaaaaaagcc ttagtgggtg 181 tcggtgtcgg cgctggtgct ggacttggat tgggagttgg tttggatctg ggattaggtt 241 taggtgcagg cgctggagta ggggcaggtg ccggccgtga ttcaagcagt agcgaagaac 301 atggatgtga cagatgcggc cataagcacc gtcacagaga tcatcatggt ggcggaaata 361 gtggtgaggg ccactttaat gtccaaacac ctcctggcag tgtaggtggc ggctatggag 421 gtggtggcgg tggtggtttt ggaagtggag gcggttttgg aggtggtttt ggaggtggta 481 gcggtggagg atatggtggt ggtgctggct tcggcggtgg ccatggatat gatggaggca 541 atggacatgg gagcagttca ggatctttcg ccacgtcaag tgcccaagcg tcctcgtcta 601 gcggaagtta ctctcatggc taaaattatt tagtaattta aattattata atataaatat 661 ccatttggtc ataaaaataa ataaacaatt ttaatatttt ttgttttgat gatatgttgg 721 acatttttat accctacatc accacagtgg tgttaaaact tttgtgcatt tgtttgcaac 781 attagcaaaa ccttaaattc caatcctaca tcaattatct tggtcttaac attgggttgt 841 ctctagagtt agattcggcc cggccgaaac aaaacacgtc gtgcaaaatt tcattccaat 901 cggataagaa ttgcgccctc tagagactca agaagtcaag acccaagatc ggtt