Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106090244


LOCUS       XM_013256377             954 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090244), mRNA.
ACCESSION   XM_013256377
VERSION     XM_013256377.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256377.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..954
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..954
                     /gene="LOC106090244"
                     /note="uncharacterized LOC106090244; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106090244"
     CDS             93..623
                     /gene="LOC106090244"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090244"
                     /protein_id="XP_013111831.1"
                     /db_xref="GeneID:106090244"
                     /translation="MQKLVIVFLVIGLTAASPHHHKSKKALVGVGVGAGAGLGLGVGL
                     DLGLGLGAGAGVGAGAGRDSSSSEEHGCDRCGHKHRHRDHHGGGNSGEGHFNVQTPPG
                     SVGGGYGGGGGGGFGSGGGFGGGFGGGSGGGYGGGAGFGGGHGYDGGNGHGSSSGSFA
                     TSSAQASSSSGSYSHG"
ORIGIN      
        1 tttatccaga caatcgaata aaacggagta gataagagta taaaatttcc ttaaaaacct
       61 ccgaacgcat tgcatcgaaa aggattattg caatgcaaaa attggtgatt gtgtttttgg
      121 ttataggcct gactgctgct tccccgcatc atcacaaatc gaaaaaagcc ttagtgggtg
      181 tcggtgtcgg cgctggtgct ggacttggat tgggagttgg tttggatctg ggattaggtt
      241 taggtgcagg cgctggagta ggggcaggtg ccggccgtga ttcaagcagt agcgaagaac
      301 atggatgtga cagatgcggc cataagcacc gtcacagaga tcatcatggt ggcggaaata
      361 gtggtgaggg ccactttaat gtccaaacac ctcctggcag tgtaggtggc ggctatggag
      421 gtggtggcgg tggtggtttt ggaagtggag gcggttttgg aggtggtttt ggaggtggta
      481 gcggtggagg atatggtggt ggtgctggct tcggcggtgg ccatggatat gatggaggca
      541 atggacatgg gagcagttca ggatctttcg ccacgtcaag tgcccaagcg tcctcgtcta
      601 gcggaagtta ctctcatggc taaaattatt tagtaattta aattattata atataaatat
      661 ccatttggtc ataaaaataa ataaacaatt ttaatatttt ttgttttgat gatatgttgg
      721 acatttttat accctacatc accacagtgg tgttaaaact tttgtgcatt tgtttgcaac
      781 attagcaaaa ccttaaattc caatcctaca tcaattatct tggtcttaac attgggttgt
      841 ctctagagtt agattcggcc cggccgaaac aaaacacgtc gtgcaaaatt tcattccaat
      901 cggataagaa ttgcgccctc tagagactca agaagtcaag acccaagatc ggtt