PREDICTED: Stomoxys calcitrans uncharacterized LOC106090243

LOCUS       XM_013256376             906 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106090243), mRNA.
ACCESSION   XM_013256376
VERSION     XM_013256376.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256376.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 40% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..906
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..906
                     /gene="LOC106090243"
                     /note="uncharacterized LOC106090243; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106090243"
     CDS             1..906
                     /gene="LOC106090243"
                     /codon_start=1
                     /product="uncharacterized protein LOC106090243"
                     /protein_id="XP_013111830.2"
                     /db_xref="GeneID:106090243"
                     /translation="MKVFVCLLAVCAVANAGFLFGGGGGGGGGGGHGGGGHGGGGGGH
                     GGGGYGGGHGGGGGGGHGGGGGGGHGGGGGGVTIFRIISDGGSGGGGGGGGGYGGGAG
                     GGHGGGHGGGGGYGGGHGGGGGYGGGHGGGGGGGSAGGSVQIYKIITLGGGGGGAGGG
                     GGGGFGGGGDAGGWSSGGAGGGGGDAGGWSSGGGGGGGDAGGWSSGGSGGCFSMPSFD
                     AVLDRKFLAMLKRVESLLQQGNGHNRCSFPESIVHLKRRINAFHLQQRDKFCSLLLDL
                     GTTMSLTTMFSTAAKFIGLNSSHGG"
ORIGIN      
        1 atgaaggttt tcgtatgttt gttggcggtc tgcgccgtgg ctaatgccgg attcttgttc
       61 ggaggtggag gaggaggtgg tggtggcggc ggccatggcg gcggtggtca cggaggtggt
      121 ggcggcggcc atggcggcgg tggctacgga ggtggccatg gaggcggcgg cggtggcggt
      181 cacggaggcg gtggaggtgg cggtcatggt ggtggtggtg gcggtgtaac aatctttaga
      241 attatttctg atggaggttc tggcggtggt ggtggcggcg gaggtggata cggtggtggt
      301 gccggaggcg gccatggtgg cggccacggt ggtggtggcg gttatggcgg cggccacggt
      361 ggtggtggcg gttatggcgg cggccacggt ggtggtggcg gtggcggctc agctggcggt
      421 tcggttcaaa tctataagat tatcacacta ggaggtggtg gtggcggcgc tggcggtggt
      481 ggtggtggcg gatttggtgg tggcggtgat gctggtggtt ggtcatctgg tggtgccggt
      541 ggtggtggcg gagatgctgg tggctggtcc tccggtggcg gcggtggtgg tggtgatgct
      601 ggtggctggt cctccggcgg ctccggtggt tgcttttcaa tgcccagctt tgacgcagta
      661 ttagatcgta aatttctcgc aatgctcaaa cgggtggaat ctttgctgca acaaggtaat
      721 ggtcataatc gatgttcgtt ccccgaatcg atcgtacatc taaaacggag gataaatgcc
      781 ttccatctac aacaacgcga caaattttgt tccttacttc tagatctggg gacaaccatg
      841 tcgctaacta ccatgttttc tactgcggcg aaatttattg gcctcaactc atctcatgga
      901 ggttaa