Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256122 777 bp mRNA linear INV 02-SEP-2023 protein 16 homolog (LOC106090066), mRNA. ACCESSION XM_013256122 VERSION XM_013256122.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256122.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..777 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..777 /gene="LOC106090066" /note="translation machinery-associated protein 16 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106090066" CDS 97..678 /gene="LOC106090066" /codon_start=1 /product="translation machinery-associated protein 16 homolog" /protein_id="XP_013111576.2" /db_xref="GeneID:106090066" /translation="MTNLRKELEKCKHPNSRKTKALSKKARRQNNKHKQRMGHAIKSN IMGEKLTWFLEHIEEGRKQPLSPEEFEQLIQLYLKRFDEELEQIALKQSISKNRANQH AARQDVIRITLEKETNEYKAGGMELLNLCDPVKFKSLMDWDGSAINVQHLKLDLVSHN MLQRFKKNTEESKGASPISTTTSSTAAEEVMET" polyA_site 777 /gene="LOC106090066" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttggtatttc ataccgtctc aaatgtcact ttagtccaaa acaaaaacaa acgtgcacgt 61 gaaaaataaa ggcaaaaggc tcgacaaatc gacaaaatga ctaatctacg aaaagaattg 121 gaaaaatgta aacatcccaa cagtcgtaaa actaaagctt tgagtaaaaa ggcccgacgt 181 caaaacaaca aacacaaaca acgaatggga catgccatca aatcaaacat aatgggtgag 241 aagttaactt ggtttttgga acacattgaa gagggccgaa aacagccatt gtcacctgag 301 gaattcgagc aactcataca attatattta aaacgtttcg atgaagaact tgaacagatt 361 gccttaaaac agtcgataag caagaataga gcaaatcaac atgcagcacg tcaagatgtt 421 atacgcatta ctttggaaaa ggaaacaaac gaatataaag caggtggaat ggagttgctg 481 aatctttgtg atcccgtcaa atttaaatcc ctaatggatt gggatggcag tgccataaat 541 gttcaacacc taaaattgga tttggtttca cataacatgt tgcaaaggtt caagaaaaat 601 accgaggaat caaaaggcgc ttcacctata agtaccacaa catcgtcaac agcggcagaa 661 gaagtaatgg agacgtgata aatgatatta atattaccaa agttctttat catataaatt 721 tcgttacata tgcgcacagg cataggaaaa taaaataaaa gatatataca agagtta