Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans translation machinery-associated


LOCUS       XM_013256122             777 bp    mRNA    linear   INV 02-SEP-2023
            protein 16 homolog (LOC106090066), mRNA.
ACCESSION   XM_013256122
VERSION     XM_013256122.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256122.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..777
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..777
                     /gene="LOC106090066"
                     /note="translation machinery-associated protein 16
                     homolog; Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 Proteins"
                     /db_xref="GeneID:106090066"
     CDS             97..678
                     /gene="LOC106090066"
                     /codon_start=1
                     /product="translation machinery-associated protein 16
                     homolog"
                     /protein_id="XP_013111576.2"
                     /db_xref="GeneID:106090066"
                     /translation="MTNLRKELEKCKHPNSRKTKALSKKARRQNNKHKQRMGHAIKSN
                     IMGEKLTWFLEHIEEGRKQPLSPEEFEQLIQLYLKRFDEELEQIALKQSISKNRANQH
                     AARQDVIRITLEKETNEYKAGGMELLNLCDPVKFKSLMDWDGSAINVQHLKLDLVSHN
                     MLQRFKKNTEESKGASPISTTTSSTAAEEVMET"
     polyA_site      777
                     /gene="LOC106090066"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttggtatttc ataccgtctc aaatgtcact ttagtccaaa acaaaaacaa acgtgcacgt
       61 gaaaaataaa ggcaaaaggc tcgacaaatc gacaaaatga ctaatctacg aaaagaattg
      121 gaaaaatgta aacatcccaa cagtcgtaaa actaaagctt tgagtaaaaa ggcccgacgt
      181 caaaacaaca aacacaaaca acgaatggga catgccatca aatcaaacat aatgggtgag
      241 aagttaactt ggtttttgga acacattgaa gagggccgaa aacagccatt gtcacctgag
      301 gaattcgagc aactcataca attatattta aaacgtttcg atgaagaact tgaacagatt
      361 gccttaaaac agtcgataag caagaataga gcaaatcaac atgcagcacg tcaagatgtt
      421 atacgcatta ctttggaaaa ggaaacaaac gaatataaag caggtggaat ggagttgctg
      481 aatctttgtg atcccgtcaa atttaaatcc ctaatggatt gggatggcag tgccataaat
      541 gttcaacacc taaaattgga tttggtttca cataacatgt tgcaaaggtt caagaaaaat
      601 accgaggaat caaaaggcgc ttcacctata agtaccacaa catcgtcaac agcggcagaa
      661 gaagtaatgg agacgtgata aatgatatta atattaccaa agttctttat catataaatt
      721 tcgttacata tgcgcacagg cataggaaaa taaaataaaa gatatataca agagtta