Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans LSM12 homolog A (LOC106090056),


LOCUS       XM_013256111            1153 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X1, mRNA.
ACCESSION   XM_013256111
VERSION     XM_013256111.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256111.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1153
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1153
                     /gene="LOC106090056"
                     /note="LSM12 homolog A; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 8 Proteins"
                     /db_xref="GeneID:106090056"
     CDS             437..1081
                     /gene="LOC106090056"
                     /codon_start=1
                     /product="LSM12 homolog A"
                     /protein_id="XP_013111565.1"
                     /db_xref="GeneID:106090056"
                     /translation="MAADNDCFSIGSTVMCTTCFNEEFEGEVLAFDHNTKMLILKCRS
                     KNADNLTDVHVLNLSLCSNVQVVKECNGNFVDDPQKLNLEQLKIRLRKTVQHRQTYLK
                     SKNAAVSPEAQELYRVIAKQFKYNEVSWQGLDIQIFKEVTIKPPYRAENVVSTSNNKS
                     LCTYIKKMIENFVNNRAAQESSASVMGTSSASSPTSSSLSSSNAASGSPVPANS"
     misc_feature    452..631
                     /gene="LOC106090056"
                     /note="Like-Sm protein 12, N-terminal domain; Region:
                     LSm12_N; cd01735"
                     /db_xref="CDD:212482"
     misc_feature    order(476..496,500..538,545..559)
                     /gene="LOC106090056"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212482"
     misc_feature    order(530..532,536..538,605..607)
                     /gene="LOC106090056"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212482"
     misc_feature    593..628
                     /gene="LOC106090056"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212482"
     misc_feature    665..937
                     /gene="LOC106090056"
                     /note="Anticodon-binding domain; Region: AD; smart00995"
                     /db_xref="CDD:214962"
     polyA_site      1153
                     /gene="LOC106090056"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaaaccacat tcgtttcttc gtattgaaag aaaaaagaaa agttgcaagt tattgcaaaa
       61 caagtattta ttcaattgaa atatagaggg tgaaaacttg tttattaatc aaaaaaagta
      121 attggtaaat ttctgaagat aaggttggga aactcagttc aagaaagagt gaaaatacaa
      181 agaaacgctg gcaaatttca agcagaacaa accaaataca aaacaaacat aaaaaagtga
      241 aaattttgtt gtgatcaggt caaatagctg ccaaccaagg gaacaagtaa ataaatatat
      301 agcgcaaccc acggggaact tccgggttta cagcgataaa atagaaggaa gaagcaacaa
      361 acaagtcaaa gctgctgcac ttactccccc catcatccgc cagcgttagg gcaatcgacg
      421 aaaacaacaa ttaaaaatgg ccgcagataa cgattgcttc agtattggat caacggtgat
      481 gtgcacgacc tgcttcaatg aggaattcga aggagaagtt cttgcatttg accataacac
      541 aaaaatgctc atcttaaaat gtcggtcaaa aaatgcagac aatttaaccg atgttcatgt
      601 cttgaatctt tctctatgta gcaatgttca agtggtcaaa gaatgtaatg gcaattttgt
      661 tgatgatcct caaaaattaa acttggaaca attgaaaata cgacttcgta aaacagtaca
      721 acatcgtcaa acgtatctca agtccaaaaa tgctgctgta agcccggagg cgcaagagtt
      781 gtacagagta attgcaaagc aatttaagta taatgaggtg tcttggcaag gtttagatat
      841 acaaatattc aaggaagtta ccataaaacc gccatatagg gcagagaacg tggtatccac
      901 atcaaataat aaaagtttat gcacctatat taagaaaatg attgaaaatt ttgttaataa
      961 tagagctgcg caagaaagta gcgcttcagt aatgggcacg tcgtcagcgt cctcgcccac
     1021 gtcatcatca ttgtcatcaa gtaatgcggc atcgggatca ccagtgccag ctaattcata
     1081 ataattataa atgttttgaa aacaaaaaaa caccaagaac aacaataaaa aatacaaaac
     1141 aaaaacggaa taa