Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013256010 1747 bp mRNA linear INV 02-SEP-2023 (LOC106089987), mRNA. ACCESSION XM_013256010 VERSION XM_013256010.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013256010.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1747 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1747 /gene="LOC106089987" /note="probable cytochrome P450 28d1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins" /db_xref="GeneID:106089987" CDS 110..1624 /gene="LOC106089987" /codon_start=1 /product="probable cytochrome P450 28d1" /protein_id="XP_013111464.1" /db_xref="GeneID:106089987" /translation="MDSLLITATLILGLLGLLYGFLISNIGGWKKKGVPEAKSYPGIG TFPATFTQSRHFIYDVDEVYRQFRNKNKYVGVYSGRAPQFLILDPELAHKIYVNDFNS FHDNEFGEYIDEKSDLISANNPFFLRGEEWKERRTEMIPGMTPNRIKSAYPVTLDVCK RLSDYINQKTKLPPQDGLDMYELCLKYTTEVVSDCVLGINAASISDNPSHLVQQVQDL FRPSTSLILQQIAISLLPCTKHIWKMTFFNKSVTKYFFDLMENAIEMRRKHSNNRVDF LNFLLHLQEKKKLPSKIMGANIMTFLTDGFFTTAQTVAHCLLYLARNPKIQEKLREEI LNNINEDGIVTFESLSEMPYLNACFNEAIRILPPLPMNTKLCTKPYEFVNSDGRSYKM KKGEVVVIIPYSYHHDERYFEEPEKFKPERFLGDKSLKEYREEGKYLGFGDGPRICMG MRFALTQGKAAIVELVRHFHLKVNPKTRNDNVLDKKEFLTRLDGGIWLDFEAIK" misc_feature 314..1600 /gene="LOC106089987" /note="cytochrome P450 family 6 and similar cytochrome P450s; Region: CYP6-like; cd11056" /db_xref="CDD:410679" misc_feature order(503..505,515..517,536..538,683..685,1007..1012, 1019..1024,1031..1036,1043..1045,1196..1198,1223..1225, 1229..1231,1313..1315,1427..1435,1445..1459,1466..1471) /gene="LOC106089987" /note="heme binding site [chemical binding]; other site" /db_xref="CDD:410679" misc_feature order(761..766,1007..1009,1016..1021,1031..1033, 1217..1228) /gene="LOC106089987" /note="putative chemical substrate binding pocket [chemical binding]; other site" /db_xref="CDD:410679" polyA_site 1747 /gene="LOC106089987" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcaaaactt ttgagttacc ggctacattt cgttacggtt gtttgacgag tacgttgata 61 aatatacaaa atttttttaa ttgaaacgat tgatttaaaa gtaaataaga tggactcttt 121 gcttattacg gccactctca ttttgggttt attggggctt ttgtatggat ttttaataag 181 caacattgga gggtggaaga agaaaggcgt gccggaagct aaatcttatc cgggcatcgg 241 aacattccca gcaacattca cccaaagccg gcattttatt tacgatgtgg atgaagtgta 301 caggcaattc cggaataaga acaaatatgt tggcgtttat tcagggcgtg cgccacagtt 361 tttaatctta gatccagaac ttgctcacaa gatatatgta aatgatttca acagtttcca 421 cgataatgaa tttggagaat atattgatga aaaatctgac ttgatatctg ctaataaccc 481 ctttttccta agaggtgaag aatggaagga acgacgcact gaaatgatac caggcatgac 541 cccaaataga attaaaagtg catatcccgt aactttggat gtgtgcaaac gtttgtcaga 601 ttatataaat caaaagacta aacttccccc tcaggatggt ttggatatgt atgaactttg 661 tcttaagtac acaacagaag tggtgagtga ttgtgttttg ggaataaacg ctgctagtat 721 ctcagacaat ccctcacatt tagtgcaaca agtacaagac ctctttagac catcaacctc 781 cttgattctg caacagattg caatatctct tctgccctgt acaaaacaca tctggaaaat 841 gacattcttc aataaatcag taacgaaata ctttttcgat ttaatggaaa atgccattga 901 aatgagacgc aagcacagca acaatcgcgt agatttctta aattttttgt tgcatctgca 961 ggaaaagaag aagttgccca gcaaaattat gggcgcaaat attatgacat tcctaactga 1021 tggttttttc actactgctc aaactgttgc acattgtttg ctgtatttgg cacgaaatcc 1081 caaaatccaa gagaagttgc gagaagaaat actgaataat attaacgaag acggtatagt 1141 gacatttgaa agtctttccg agatgcctta tttaaatgca tgttttaacg aagccattcg 1201 tatcttgcca ccactgccaa tgaataccaa actctgcacc aaaccttatg agtttgtaaa 1261 cagtgacggt cgatcgtaca aaatgaaaaa gggagaagtt gtcgttatta ttccgtacag 1321 ctatcatcac gacgaacgat attttgaaga gcctgaaaag tttaagcccg aacgattttt 1381 gggggataaa agccttaagg aatacagaga ggaaggcaaa tatttgggtt ttggtgatgg 1441 accacgcata tgcatgggta tgcgatttgc tttaactcaa gggaaagcgg ctattgtaga 1501 gctggtgcgt cacttccatc tcaaagtgaa tcctaaaact cgtaatgaca atgttttgga 1561 taagaaggaa tttttgactc gcctggatgg tggtatatgg ttggattttg aggcaataaa 1621 gtaatcaaca ctctaatctc tcgagaaaca aaggatgggc gagcgggata aaggtttaaa 1681 ttcagaatca ttaataattc aaataactgt actgtgtgtt tataataaag aaaaatagga 1741 tggcaga