Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable cytochrome P450 28d1


LOCUS       XM_013256010            1747 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089987), mRNA.
ACCESSION   XM_013256010
VERSION     XM_013256010.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013256010.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1747
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1747
                     /gene="LOC106089987"
                     /note="probable cytochrome P450 28d1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 14
                     Proteins"
                     /db_xref="GeneID:106089987"
     CDS             110..1624
                     /gene="LOC106089987"
                     /codon_start=1
                     /product="probable cytochrome P450 28d1"
                     /protein_id="XP_013111464.1"
                     /db_xref="GeneID:106089987"
                     /translation="MDSLLITATLILGLLGLLYGFLISNIGGWKKKGVPEAKSYPGIG
                     TFPATFTQSRHFIYDVDEVYRQFRNKNKYVGVYSGRAPQFLILDPELAHKIYVNDFNS
                     FHDNEFGEYIDEKSDLISANNPFFLRGEEWKERRTEMIPGMTPNRIKSAYPVTLDVCK
                     RLSDYINQKTKLPPQDGLDMYELCLKYTTEVVSDCVLGINAASISDNPSHLVQQVQDL
                     FRPSTSLILQQIAISLLPCTKHIWKMTFFNKSVTKYFFDLMENAIEMRRKHSNNRVDF
                     LNFLLHLQEKKKLPSKIMGANIMTFLTDGFFTTAQTVAHCLLYLARNPKIQEKLREEI
                     LNNINEDGIVTFESLSEMPYLNACFNEAIRILPPLPMNTKLCTKPYEFVNSDGRSYKM
                     KKGEVVVIIPYSYHHDERYFEEPEKFKPERFLGDKSLKEYREEGKYLGFGDGPRICMG
                     MRFALTQGKAAIVELVRHFHLKVNPKTRNDNVLDKKEFLTRLDGGIWLDFEAIK"
     misc_feature    314..1600
                     /gene="LOC106089987"
                     /note="cytochrome P450 family 6 and similar cytochrome
                     P450s; Region: CYP6-like; cd11056"
                     /db_xref="CDD:410679"
     misc_feature    order(503..505,515..517,536..538,683..685,1007..1012,
                     1019..1024,1031..1036,1043..1045,1196..1198,1223..1225,
                     1229..1231,1313..1315,1427..1435,1445..1459,1466..1471)
                     /gene="LOC106089987"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:410679"
     misc_feature    order(761..766,1007..1009,1016..1021,1031..1033,
                     1217..1228)
                     /gene="LOC106089987"
                     /note="putative chemical substrate binding pocket
                     [chemical binding]; other site"
                     /db_xref="CDD:410679"
     polyA_site      1747
                     /gene="LOC106089987"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcaaaactt ttgagttacc ggctacattt cgttacggtt gtttgacgag tacgttgata
       61 aatatacaaa atttttttaa ttgaaacgat tgatttaaaa gtaaataaga tggactcttt
      121 gcttattacg gccactctca ttttgggttt attggggctt ttgtatggat ttttaataag
      181 caacattgga gggtggaaga agaaaggcgt gccggaagct aaatcttatc cgggcatcgg
      241 aacattccca gcaacattca cccaaagccg gcattttatt tacgatgtgg atgaagtgta
      301 caggcaattc cggaataaga acaaatatgt tggcgtttat tcagggcgtg cgccacagtt
      361 tttaatctta gatccagaac ttgctcacaa gatatatgta aatgatttca acagtttcca
      421 cgataatgaa tttggagaat atattgatga aaaatctgac ttgatatctg ctaataaccc
      481 ctttttccta agaggtgaag aatggaagga acgacgcact gaaatgatac caggcatgac
      541 cccaaataga attaaaagtg catatcccgt aactttggat gtgtgcaaac gtttgtcaga
      601 ttatataaat caaaagacta aacttccccc tcaggatggt ttggatatgt atgaactttg
      661 tcttaagtac acaacagaag tggtgagtga ttgtgttttg ggaataaacg ctgctagtat
      721 ctcagacaat ccctcacatt tagtgcaaca agtacaagac ctctttagac catcaacctc
      781 cttgattctg caacagattg caatatctct tctgccctgt acaaaacaca tctggaaaat
      841 gacattcttc aataaatcag taacgaaata ctttttcgat ttaatggaaa atgccattga
      901 aatgagacgc aagcacagca acaatcgcgt agatttctta aattttttgt tgcatctgca
      961 ggaaaagaag aagttgccca gcaaaattat gggcgcaaat attatgacat tcctaactga
     1021 tggttttttc actactgctc aaactgttgc acattgtttg ctgtatttgg cacgaaatcc
     1081 caaaatccaa gagaagttgc gagaagaaat actgaataat attaacgaag acggtatagt
     1141 gacatttgaa agtctttccg agatgcctta tttaaatgca tgttttaacg aagccattcg
     1201 tatcttgcca ccactgccaa tgaataccaa actctgcacc aaaccttatg agtttgtaaa
     1261 cagtgacggt cgatcgtaca aaatgaaaaa gggagaagtt gtcgttatta ttccgtacag
     1321 ctatcatcac gacgaacgat attttgaaga gcctgaaaag tttaagcccg aacgattttt
     1381 gggggataaa agccttaagg aatacagaga ggaaggcaaa tatttgggtt ttggtgatgg
     1441 accacgcata tgcatgggta tgcgatttgc tttaactcaa gggaaagcgg ctattgtaga
     1501 gctggtgcgt cacttccatc tcaaagtgaa tcctaaaact cgtaatgaca atgttttgga
     1561 taagaaggaa tttttgactc gcctggatgg tggtatatgg ttggattttg aggcaataaa
     1621 gtaatcaaca ctctaatctc tcgagaaaca aaggatgggc gagcgggata aaggtttaaa
     1681 ttcagaatca ttaataattc aaataactgt actgtgtgtt tataataaag aaaaatagga
     1741 tggcaga