Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255879 463 bp mRNA linear INV 02-SEP-2023 transcript variant X1, mRNA. ACCESSION XM_013255879 VERSION XM_013255879.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255879.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..463 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..463 /gene="LOC106089886" /note="protein stunted-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 Proteins" /db_xref="GeneID:106089886" CDS 110..298 /gene="LOC106089886" /codon_start=1 /product="protein stunted-like" /protein_id="XP_013111333.1" /db_xref="GeneID:106089886" /translation="MTNAWRAAGLTYIQYSNICARVVRQALKADLRADAAKRSESHVK FTPWANGKPAPRTQGAAE" misc_feature 119..262 /gene="LOC106089886" /note="Mitochondrial ATP synthase epsilon chain; Region: ATP-synt_Eps; pfam04627" /db_xref="CDD:461373" misc_feature order(122..127,137..148,155..160,170..172,221..253) /gene="LOC106089886" /note="gamma subunit interface [polypeptide binding]; other site" /db_xref="CDD:213396" misc_feature order(143..145,152..169,182..193,200..202,221..223) /gene="LOC106089886" /note="delta subunit interface [polypeptide binding]; other site" /db_xref="CDD:213396" polyA_site 463 /gene="LOC106089886" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atcgattttg ctccaccatt gtagattttc ctgacagact acacgagctg ccgacaattt 61 tgcaaaattt atctttaaaa taaagtaaat taaataaatc caaagcaaaa tgactaacgc 121 ctggagagcc gctggactta cctacattca atactccaac atctgcgccc gtgtagtgcg 181 tcaagccttg aaggctgatt tgcgtgccga tgctgccaaa cgtagcgaga gccatgtcaa 241 atttactcct tgggctaatg gaaaacctgc acctcgtacc caaggcgctg ccgaataaat 301 ttaaccaatt tctttttggt taagtttaca tatataaatc tataaaaatt cctccaaatc 361 tgaattcatc atagaaacgg ttgaaataaa atttttaaat taatttcgaa atgtttgtgc 421 tggaagcaaa aacataaata aaacaattta atgaaaagga aaa