Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein stunted-like (LOC106089886),


LOCUS       XM_013255879             463 bp    mRNA    linear   INV 02-SEP-2023
            transcript variant X1, mRNA.
ACCESSION   XM_013255879
VERSION     XM_013255879.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255879.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..463
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..463
                     /gene="LOC106089886"
                     /note="protein stunted-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 13
                     Proteins"
                     /db_xref="GeneID:106089886"
     CDS             110..298
                     /gene="LOC106089886"
                     /codon_start=1
                     /product="protein stunted-like"
                     /protein_id="XP_013111333.1"
                     /db_xref="GeneID:106089886"
                     /translation="MTNAWRAAGLTYIQYSNICARVVRQALKADLRADAAKRSESHVK
                     FTPWANGKPAPRTQGAAE"
     misc_feature    119..262
                     /gene="LOC106089886"
                     /note="Mitochondrial ATP synthase epsilon chain; Region:
                     ATP-synt_Eps; pfam04627"
                     /db_xref="CDD:461373"
     misc_feature    order(122..127,137..148,155..160,170..172,221..253)
                     /gene="LOC106089886"
                     /note="gamma subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213396"
     misc_feature    order(143..145,152..169,182..193,200..202,221..223)
                     /gene="LOC106089886"
                     /note="delta subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:213396"
     polyA_site      463
                     /gene="LOC106089886"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atcgattttg ctccaccatt gtagattttc ctgacagact acacgagctg ccgacaattt
       61 tgcaaaattt atctttaaaa taaagtaaat taaataaatc caaagcaaaa tgactaacgc
      121 ctggagagcc gctggactta cctacattca atactccaac atctgcgccc gtgtagtgcg
      181 tcaagccttg aaggctgatt tgcgtgccga tgctgccaaa cgtagcgaga gccatgtcaa
      241 atttactcct tgggctaatg gaaaacctgc acctcgtacc caaggcgctg ccgaataaat
      301 ttaaccaatt tctttttggt taagtttaca tatataaatc tataaaaatt cctccaaatc
      361 tgaattcatc atagaaacgg ttgaaataaa atttttaaat taatttcgaa atgtttgtgc
      421 tggaagcaaa aacataaata aaacaattta atgaaaagga aaa