Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255872 946 bp mRNA linear INV 02-SEP-2023 ACCESSION XM_013255872 VERSION XM_013255872.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255872.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..946 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..946 /gene="LOC106089881" /note="protein Dr1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106089881" CDS 94..624 /gene="LOC106089881" /codon_start=1 /product="protein Dr1" /protein_id="XP_013111326.1" /db_xref="GeneID:106089881" /translation="MSNPQDELCPPPSEDDELTLPRASINKIIKELVPSVRVANESRE LLLNCCSEFIHLISSEANDVCNVRNKKTINAEHVLEALDRLGFRDYKQEAEAVLNDCK EVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAQEEQQQWISMQASAVQQSR QMQSIGEDDDEDDDDY" misc_feature 136..504 /gene="LOC106089881" /note="histone-fold domain found in protein Dr1 and similar proteins; Region: HFD_Dr1; cd22905" /db_xref="CDD:467030" misc_feature order(139..141,145..156,163..165,175..180,184..192, 202..210,217..219,226..231,238..243,247..258,265..270, 277..279,307..318,325..327,361..363,370..372,382..384, 394..396) /gene="LOC106089881" /note="heterodimer interface [polypeptide binding]; other site" /db_xref="CDD:467030" misc_feature order(148..150,154..162,301..309,397..399,415..420) /gene="LOC106089881" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:467030" misc_feature order(457..459,466..471,475..480,487..492,499..504) /gene="LOC106089881" /note="TBP binding site [polypeptide binding]; other site" /db_xref="CDD:467030" polyA_site 946 /gene="LOC106089881" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 acacataatc ctgcgtcaat gttttgttta caatactctt ttaattaatt tttgaacaag 61 tatttttaaa aattatttaa ttgtgccgta gaaatgagta atccacagga tgaactatgt 121 ccaccaccat cagaagatga tgagttaaca ttgcctagag ccagtataaa taaaatcatc 181 aaagaattgg tgccctcagt cagagtggca aatgaaagtc gtgaacttct gctaaactgc 241 tgctccgaat tcattcatct catcagctct gaagccaatg atgtttgtaa tgttcgaaat 301 aaaaaaacca taaacgctga acacgtttta gaggcattag atcgtttagg gtttcgtgat 361 tataaacaag aggctgaggc tgtattaaat gattgcaaag aggtggctgc caaacgccgt 421 cgacaaagca ctcgtttgga aaacttgggc ataccagagg aggaactgtt gagacaacag 481 caagaattgt ttgcaaaagc acgcgaagaa caggcccaag aggaacaaca gcaatggata 541 agtatgcaag catctgctgt gcagcaaagc cgacaaatgc aatccatcgg agaggatgat 601 gacgaagatg atgacgatta ctagggaagc gaatgatgat gaagttctac aaaactagtt 661 taaggtatac catagacata aaaaaaaaca ggagaaatgg atgtcttgtg caaaggcaag 721 aagtttcatt agacgattgc cttggtagtt atcaaaggag ttgtaaattg aaaaaagact 781 ataaataata ataaaagaat tcttttgtat gtaaataaat gtaagcggtt tatttgtccg 841 cagtaataaa attcagatag cccatatcgc tttgatgaac ataggagaga aatttctgca 901 ctccactatg ttccggtata tgcagctgcc taaattttta tatgta