Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein Dr1 (LOC106089881), mRNA.


LOCUS       XM_013255872             946 bp    mRNA    linear   INV 02-SEP-2023
ACCESSION   XM_013255872
VERSION     XM_013255872.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255872.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..946
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..946
                     /gene="LOC106089881"
                     /note="protein Dr1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 7 Proteins"
                     /db_xref="GeneID:106089881"
     CDS             94..624
                     /gene="LOC106089881"
                     /codon_start=1
                     /product="protein Dr1"
                     /protein_id="XP_013111326.1"
                     /db_xref="GeneID:106089881"
                     /translation="MSNPQDELCPPPSEDDELTLPRASINKIIKELVPSVRVANESRE
                     LLLNCCSEFIHLISSEANDVCNVRNKKTINAEHVLEALDRLGFRDYKQEAEAVLNDCK
                     EVAAKRRRQSTRLENLGIPEEELLRQQQELFAKAREEQAQEEQQQWISMQASAVQQSR
                     QMQSIGEDDDEDDDDY"
     misc_feature    136..504
                     /gene="LOC106089881"
                     /note="histone-fold domain found in protein Dr1 and
                     similar proteins; Region: HFD_Dr1; cd22905"
                     /db_xref="CDD:467030"
     misc_feature    order(139..141,145..156,163..165,175..180,184..192,
                     202..210,217..219,226..231,238..243,247..258,265..270,
                     277..279,307..318,325..327,361..363,370..372,382..384,
                     394..396)
                     /gene="LOC106089881"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:467030"
     misc_feature    order(148..150,154..162,301..309,397..399,415..420)
                     /gene="LOC106089881"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:467030"
     misc_feature    order(457..459,466..471,475..480,487..492,499..504)
                     /gene="LOC106089881"
                     /note="TBP binding site [polypeptide binding]; other site"
                     /db_xref="CDD:467030"
     polyA_site      946
                     /gene="LOC106089881"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acacataatc ctgcgtcaat gttttgttta caatactctt ttaattaatt tttgaacaag
       61 tatttttaaa aattatttaa ttgtgccgta gaaatgagta atccacagga tgaactatgt
      121 ccaccaccat cagaagatga tgagttaaca ttgcctagag ccagtataaa taaaatcatc
      181 aaagaattgg tgccctcagt cagagtggca aatgaaagtc gtgaacttct gctaaactgc
      241 tgctccgaat tcattcatct catcagctct gaagccaatg atgtttgtaa tgttcgaaat
      301 aaaaaaacca taaacgctga acacgtttta gaggcattag atcgtttagg gtttcgtgat
      361 tataaacaag aggctgaggc tgtattaaat gattgcaaag aggtggctgc caaacgccgt
      421 cgacaaagca ctcgtttgga aaacttgggc ataccagagg aggaactgtt gagacaacag
      481 caagaattgt ttgcaaaagc acgcgaagaa caggcccaag aggaacaaca gcaatggata
      541 agtatgcaag catctgctgt gcagcaaagc cgacaaatgc aatccatcgg agaggatgat
      601 gacgaagatg atgacgatta ctagggaagc gaatgatgat gaagttctac aaaactagtt
      661 taaggtatac catagacata aaaaaaaaca ggagaaatgg atgtcttgtg caaaggcaag
      721 aagtttcatt agacgattgc cttggtagtt atcaaaggag ttgtaaattg aaaaaagact
      781 ataaataata ataaaagaat tcttttgtat gtaaataaat gtaagcggtt tatttgtccg
      841 cagtaataaa attcagatag cccatatcgc tttgatgaac ataggagaga aatttctgca
      901 ctccactatg ttccggtata tgcagctgcc taaattttta tatgta